KEGG   Equus caballus (horse): 100068388Help
Entry
100068388         CDS       T01058                                 

Gene name
PLK1
Definition
(RefSeq) serine/threonine-protein kinase PLK1
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04068  FoxO signaling pathway
ecb04110  Cell cycle
ecb04114  Oocyte meiosis
ecb04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100068388 (PLK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100068388 (PLK1)
   04114 Oocyte meiosis
    100068388 (PLK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100068388 (PLK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100068388 (PLK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ecb03036]
    100068388 (PLK1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     100068388 (PLK1)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   100068388 (PLK1)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100068388 (PLK1)
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100068388 (PLK1)
  Sister chromatid separation proteins
   Polo kinases
    100068388 (PLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase POLO_box Pkinase_Tyr Kinase-like Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 100068388
NCBI-ProteinID: XP_023471885
Ensembl: ENSECAG00000017777
VGNC: 21579
Position
13
AA seq 604 aa AA seqDB search
MSAAATAGKLARAPADPGKAGAPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYLRGRFLG
KGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQKEKMSMEISIHRSLAHQHVVGFHGFF
EDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLG
NLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCI
MYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTIHELL
NDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGVENPMPERPREKEE
PVVRETSEAVDCHLGDMLQQLHSVNASRPSERGLVRQEEAEDPACIPIFWVSKWVDYSDK
YGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLK
YFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGCVQINFFQDHTK
LILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCSKELASRLRYARTMVDKLLSSRSATNRL
KASS
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggcggcaactgcagggaagctggcgcgggcaccagccgacccagggaaagcc
ggggcacctggagttgcagctcccggggccccggcggctgccccgccggcgaaagagatc
ccggaggtcctagtggacccgcgcagccgccggcgctatctgcggggccgctttctgggg
aagggcggctttgccaagtgcttcgagatctcggacgcagacactaaggaagtgttcgca
ggcaagattgtgccaaagtcgctgctgctcaagccgcaccagaaggagaagatgtccatg
gagatatccattcaccgcagcctcgcccaccagcacgtcgtaggcttccacggcttcttc
gaggacaacgacttcgtgttcgtagtgttggagctctgccgccggagatctctcctggag
ctgcacaaacggaggaaagcactcaccgagcccgaggcccgctactacctgcggcagatc
gtcctcggctgccagtacctgcaccgaaaccgggttattcaccgggacctcaagctgggc
aacctcttcctgaacgaggatctggaggtgaaaataggggattttggactggcaaccaaa
gtcgaatatgatggggagcggaagaagaccctgtgcgggactcctaactacatagctcct
gaggtgctgagcaagaaagggcacagcttcgaggtggacgtgtggtccattgggtgcatc
atgtataccttgttagtgggcaagccgccttttgagacctcttgcctaaaagagacctac
ctccggatcaagaagaatgaatacagcattcccaagcacatcaacccggtggccgcctcc
ctcatccagaagatgctgcagacagatcccactgcccgcccgaccattcacgagctgctc
aatgacgagtttttcacttctggctatatccctgcccgtctccccatcacctgcctcacc
attccaccgaggttctcaatcgctcccagcagcctggaccccagcaaccggaagcctctc
acagtcctcaataaaggtgtagagaaccccatgcccgagcggccccgggaaaaagaggaa
ccagtggtccgggagaccagcgaggcagtcgactgccaccttggtgacatgctgcagcag
ctgcacagcgtcaatgcctccaggccctccgagcgggggctggtgaggcaagaggaggct
gaggatcccgcctgcatccccatcttctgggtcagcaagtgggtggactattcggacaag
tacggcctcgggtatcagctgtgtgacaacagcgtaggggtgctcttcaatgactctacg
cgcctcatcctgtacaatgatggcgacagcctgcagtacatagagcgtgatggcaccgag
tcctacctcaccgtgagttcccatcccaactccttgatgaagaagatcactcttcttaag
tatttccgaaactacatgagtgaacacttgttgaaggcgggcgccaatatcacgccccgg
gaaggtgacgagctagcccggctaccctacctgcggacctggtttcgcacccgtagcgcc
atcatcctgcacctcagtaatggctgtgtgcagatcaacttcttccaggaccataccaaa
ctcatcctgtgcccgctgatggcagccgtgacctacatcgacgagaagcgggacttccgc
acgtaccgcctgagcctcctggaggagtacggctgctccaaggagctggccagccggctc
cgctacgcccgcaccatggtggacaagctgctgagctcacgctcggccaccaatcgcctc
aaggcctcctcgtag

DBGET integrated database retrieval system