KEGG   Equus caballus (horse): 100069086Help
Entry
100069086         CDS       T01058                                 

Gene name
IDH2
Definition
(RefSeq) isocitrate dehydrogenase [NADP], mitochondrial
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00020  Citrate cycle (TCA cycle)
ecb00480  Glutathione metabolism
ecb01100  Metabolic pathways
ecb01200  Carbon metabolism
ecb01210  2-Oxocarboxylic acid metabolism
ecb01230  Biosynthesis of amino acids
ecb04146  Peroxisome
Module
ecb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100069086 (IDH2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100069086 (IDH2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100069086 (IDH2)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     100069086 (IDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 100069086
NCBI-ProteinID: XP_023505642
Ensembl: ENSECAG00000007105
Position
1
AA seq 452 aa AA seqDB search
MAGYLRVVRSLCRASGSGPAWAPAALTGPSLQEQPRRHYADKRIKVAKPVVEMDGDEMTR
IIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQVTIDSALATQKYSVAVKCATITPDE
ARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWSKPITIGRHAHGDQYK
ATDFVVDRAGTFKIVFTPKDGSSAKEWEVYNFPDGGVGMGMYNTDKSISGFAHSCFQYAI
QKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKS
SGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQK
GRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQTLEKVCVETVESGAMTKDLAGCIH
GLSNVKLNEHFLNTSDFLDAIKSSLDRALGQQ
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggccggctacctgcgggtcgtacgctcgctctgcagagcctccggctccgggccagcc
tgggcgccggcagccctgacaggccccagcttgcaggagcagccgcggcgccactatgct
gacaagaggatcaaggtggcaaagccggtggtggagatggatggcgatgagatgacccgt
atcatctggcagttcatcaaagagaagctcatcctgccccacgttgacgtccagctcaag
tatttcgacctggggctcccaaatcgtgaccagaccaacgaccaggtcaccatcgactcc
gcgttggccacccagaagtacagtgtggctgtcaagtgtgccaccatcacccctgatgag
gcccgtgtggaagagttcaagctgaagaagatgtggaagagtccgaatggaaccatccgg
aacatcctcggggggactgtcttccgggagcccatcatctgcaaaaacatccctcgcctt
gtccctggctggagcaagcccatcaccattggcaggcacgcccatggcgaccagtacaag
gccacagactttgtcgtcgaccgggccggcacgttcaagatagtattcaccccgaaggac
ggcagcagtgccaaggagtgggaggtgtacaacttccctgatggtggcgtgggcatgggc
atgtacaacaccgacaagtccatctcgggtttcgcgcacagctgcttccagtatgccatc
cagaagaagtggcccctctacatgagcaccaagaacaccattctgaaagcctatgacggg
cgcttcaaggacatcttccaggagatctttgacaagcactataagaccgacttcgacaag
aataagatctggtacgagcaccggctcattgatgacatggtggctcaggtcctcaagtct
tccggcggctttgtgtgggcctgcaagaactacgacggagacgtgcagtcggatatcctg
gcccagggcttcggctcccttggcctgatgacgtccgtgctggtctgcccagatgggaag
accatcgaggctgaggctgctcatgggacagtcacccgccactatcgggagcaccaaaag
ggccggcctaccagcaccaaccccatcgccagcatctttgcctggacgcgtggcctggag
caccgggggaagctggacgggaaccaggacctcatcaggtttgcccagacgctggagaag
gtgtgcgtggagacagtggagagcggagccatgaccaaggacctggcaggctgcattcac
ggcctcagcaatgtgaagctgaacgagcacttcctgaacacctcggacttcctggacgcc
atcaagagcagcctggacagagccctgggccagcagtag

DBGET integrated database retrieval system