KEGG   Equus caballus (horse): 100069096Help
Entry
100069096         CDS       T01058                                 

Gene name
RXRA
Definition
(RefSeq) retinoic acid receptor RXR-alpha isoform X1
  KO
K08524  retinoid X receptor alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb03320  PPAR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04659  Th17 cell differentiation
ecb04919  Thyroid hormone signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04932  Non-alcoholic fatty liver disease (NAFLD)
ecb04976  Bile secretion
ecb05160  Hepatitis C
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05216  Thyroid cancer
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100069096 (RXRA)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    100069096 (RXRA)
  Endocrine system
   04920 Adipocytokine signaling pathway
    100069096 (RXRA)
   03320 PPAR signaling pathway
    100069096 (RXRA)
   04919 Thyroid hormone signaling pathway
    100069096 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    100069096 (RXRA)
  Digestive system
   04976 Bile secretion
    100069096 (RXRA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100069096 (RXRA)
   05202 Transcriptional misregulation in cancers
    100069096 (RXRA)
   05226 Gastric cancer
    100069096 (RXRA)
   05216 Thyroid cancer
    100069096 (RXRA)
   05222 Small cell lung cancer
    100069096 (RXRA)
   05223 Non-small cell lung cancer
    100069096 (RXRA)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100069096 (RXRA)
  Infectious diseases
   05160 Hepatitis C
    100069096 (RXRA)
Transcription factors [BR:ecb03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100069096 (RXRA)
Nuclear receptors [BR:ecb03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100069096 (RXRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Motif
Other DBs
NCBI-GeneID: 100069096
NCBI-ProteinID: XP_005605975
Ensembl: ENSECAG00000019365
VGNC: 22639
UniProt: F7E228
Position
25
AA seq 439 aa AA seqDB search
MAAPSLHPSLGPGMGSSLGSPGQLHSPISSLSSPINGMGPPFSVISSPMGPHSMSVPTTP
TLGFGTGSPQLNSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSS
GKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKRE
AVQEERQRGKDRNENEVESTSSANEDMPVEKILEAELAVEPKTEAYVEANVGLNPSSPND
PVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDG
ILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGL
SNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIG
DTPIDTFLMEMLEAPHQMT
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggccgccccctcgctgcacccctccctagggcctggcatgggctcctcgctcggctcc
cccggacagctgcactcgcccatcagctccttgagctcgcccatcaacggcatgggcccg
cccttctccgtcatcagctcccccatgggcccccactccatgtccgtgcccaccacacct
accctgggcttcggcactggcagcccccagctcaactcgcccatgaaccccgtcagcagc
agcgaggacatcaagcccccgctgggcctgaacggcgtcctcaaggtcccggcccacccc
tcagggaacatggcatccttcaccaagcacatctgtgccatctgcggggaccgctcctca
ggcaagcactacggggtgtacagctgcgagggctgcaagggcttcttcaagcggacggtg
cgcaaggacctgacctacacctgccgggacaacaaggactgtctgatcgacaagcggcag
cgcaaccgctgccagtactgccgctaccagaagtgcctggccatgggcatgaagcgggaa
gccgtgcaggaggagcggcagcggggcaaggacaggaatgagaatgaggtggagtccacg
agcagcgcaaacgaggacatgccggtggagaagatcctagaggctgagctggctgtggag
cccaagactgaggcatacgtggaggcgaacgtggggctgaaccccagctcgcccaacgac
cctgtcaccaacatctgccaggcagcggacaagcagctcttcaccctggtggagtgggcc
aagcggatcccgcacttctccgagctgcccctggacgaccaggtcatcctgctgcgggca
ggctggaacgagctgctcatcgcctccttctcccaccggtccatagctgtgaaggacggg
atcctgctcgccaccgggctgcacgtgcaccggaacagcgcccacagcgcgggggtgggc
gccatcttcgacagggtgctgacggagcttgtgtccaagatgcgcgacatgcagatggac
aagacggagctgggctgcctgcgtgccatcgtcctcttcaacccggactccaaggggctc
tcgaacccggccgaggtggaggccctgcgggagaaggtctacgcgtccctggaggcctac
tgcaaacacaagtaccccgagcagccgggaaggttcgccaagctgctgctgcgcctgcct
gccctgcgctccatcggcctcaagtgcctggaacatctcttcttcttcaagctcattggg
gacacgcccatcgacaccttcctcatggagatgctggaagccccgcaccaaatgacttag

DBGET integrated database retrieval system