KEGG   Equus caballus (horse): 100069399Help
Entry
100069399         CDS       T01058                                 

Gene name
HIBCH
Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial isoform X1
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00280  Valine, leucine and isoleucine degradation
ecb00410  beta-Alanine metabolism
ecb00640  Propanoate metabolism
ecb01100  Metabolic pathways
ecb01200  Carbon metabolism
Module
ecb_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100069399 (HIBCH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100069399 (HIBCH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100069399 (HIBCH)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     100069399 (HIBCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1 DUF4600
Motif
Other DBs
NCBI-GeneID: 100069399
NCBI-ProteinID: XP_023477981
VGNC: 51457
Position
18
AA seq 385 aa AA seqDB search
MRSGEMWRLLSRFNSFRRTHVILQHLRMSKHTDAAEVLLERKGCAGVITLNRPKLLNTLT
VGMIRQIYTQLKKWEQDPETFLIIIKGAGGKAFCAGGDIRAISEIGNKNQKILQDFFREE
YMLNNYIASYRKPYVALIHGITMGGGVGVSVHGQFRVATEKSLFAMPETAIGLFPDVGGG
YFLPRLQGKLGYFLGLTGFRLKGRDVYTAGIATHFVDSEKLDTLEEDLSALKAPSSENVA
DVLETYHTKSKIDRDKSFILEEHMDKINSCFSANTVEQIIENLRQDGSSFALEQLKVINK
MSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQSCMRGHDFYEGVRALLIDKDQSPKWKP
ADLKEVTDEDLNNHFKSLGHNDLKF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcggtcgggcgagatgtggaggctcctgtcgaggtttaattcattcagaaggactcat
gtcatactgcaacacttgagaatgtcaaagcacacagatgcagcagaagtactattggaa
agaaaaggttgtgcaggagtgataacactaaacagaccaaagttactaaatacactgact
gtcggtatgattcggcagatttatacacagctaaagaagtgggaacaagatcctgaaact
ttcctgatcattataaagggagctggagggaaggctttctgtgctgggggtgatatcaga
gcaatttcagaaattggaaataaaaaccagaagatacttcaagatttcttcagagaagaa
tatatgctgaacaattatattgcttcttaccggaagccatatgttgcacttattcatgga
attacaatgggtgggggagttggtgtctcagttcatgggcagttccgagtggctactgaa
aagtctctttttgcaatgccagaaacagcaataggactatttcctgatgtgggtggaggt
tatttcttgccacgacttcaaggaaaacttggttacttccttggattaacaggattcagg
ctaaaaggaagagatgtgtacacagcaggcattgccacgcactttgtagattctgaaaag
ttggacacgttagaagaagatttatcagccctgaaggctccttcaagtgaaaatgttgca
gatgtcttagaaacttaccatacaaagtccaagattgatcgagacaagtcctttatactt
gaggaacacatggacaaaataaacagttgtttctcggccaatactgtggaacagattatt
gaaaatttacggcaagatggttcatcttttgccctagagcagttgaaggtaattaataaa
atgtctccaacatcattaaagatcacactaagacaactcatggagggctcctcaaagacc
ttgcaagaggtattaactatggaatatcggctgagccaatcttgtatgagaggccatgac
ttttatgaaggcgttagggcacttttaatagataaagaccagagtccgaagtggaaacca
gctgatttaaaagaagttactgatgaagatttgaataatcactttaaatctctgggacac
aatgatttgaaattttga

DBGET integrated database retrieval system