KEGG   Equus caballus (horse): 100069500Help
Entry
100069500         CDS       T01058                                 

Gene name
CTSO
Definition
(RefSeq) cathepsin O
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04142  Lysosome
ecb04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100069500 (CTSO)
  09143 Cell growth and death
   04210 Apoptosis
    100069500 (CTSO)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecb01002]
    100069500 (CTSO)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     100069500 (CTSO)
Peptidases and inhibitors [BR:ecb01002]
 Cysteine peptidases
  Family C1: papain family
   100069500 (CTSO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Peptidase_C1_2 DUF2477 Peptidase_C39_2
Motif
Other DBs
NCBI-GeneID: 100069500
NCBI-ProteinID: XP_001499302
Ensembl: ENSECAG00000020037
VGNC: 16954
Position
2
AA seq 367 aa AA seqDB search
MGTKEASESPGRRTPLRCSRPSNPGRGGAEESKEKVAEAGAPALGSGMELQALWRLWLLC
CCCCCCICCGSSATFTSNRPRSGDRQAAAFRESLNRHRYLNSLFPSENSTAVYGINQFSY
LFPEEFKAIYLRSKPSRFPRYPAEVQTSLSNVSLPLRFDWRDRHVVTQVRNQQACGGCWA
FSVVGAVESVCAIKGEPLEDLSVQQVIDCSYNNYGCSGGSTLNALNWLNKTQVKLVRDSE
YPFKAQSGLCHYFSDSHSGFSIKGFSAYDFSDQEDQMAKALLTFGPLVVVVDAVSWQDYL
GGVIQHHCSSGEANHAVLITGFDRTGSTPYWIVRNSWGSSWGVDGYAHVKMGGNICGIAD
SVSAVFV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggggactaaggaagcgtcagagtctccaggacgccgcaccccgctccgctgctcccgc
ccctcaaaccctgggaggggcggagcagaggaatcgaaagagaaagtggcggaggctggc
gccccggccttgggctcagggatggagctgcaggcgctgtggcggctctggttgctctgc
tgctgctgctgctgctgcatctgctgtggctccagcgccaccttcacctccaaccggccg
cggagcggtgaccgacaggcagccgccttccgggaaagtcttaatagacatcgatacttg
aattctttatttcctagtgaaaactccactgctgtctatgggataaatcagttttcttat
ttgtttcctgaagagtttaaagctatttatttaagaagcaaaccttccagatttcccaga
tacccagcagaagtgcaaacatctctctccaacgtgtctttgccattaagatttgactgg
agggaccggcatgttgtaacacaagtgagaaaccagcaggcgtgtggaggatgctgggcc
ttcagcgtggtgggtgcagtggaatctgtatgtgcaataaaaggggagcccttggaagac
ctgagtgtacagcaggtcattgattgttcatataataattacggctgcagtggaggatct
actctcaatgctttgaactggttaaacaagacgcaagtaaaactggtgagagactcagaa
tacccatttaaagcacagagtggcctgtgccattacttttctgattcacattctggattt
tcaatcaaaggtttttctgcatatgacttcagtgaccaagaagaccaaatggcaaaggca
cttcttacttttggccctttagtagtggtagtagatgcggtgagctggcaagattatctg
ggaggcgtaatacagcatcattgctctagtggagaagcgaatcatgcagtcctcataact
gggtttgatagaacaggaagtactccatattggattgtgcggaactcgtggggaagttcc
tggggagtagatggctatgcccatgttaaaatgggaggtaatatttgtggtattgcagat
tccgtttctgctgtatttgtgtga

DBGET integrated database retrieval system