KEGG   Equus caballus (horse): 100069542
Entry
100069542         CDS       T01058                                 

Gene name
RAB3A
Definition
(RefSeq) ras-related protein Rab-3A
  KO
K07882  Ras-related protein Rab-3A
Organism
ecb  Equus caballus (horse)
Pathway
ecb04721  Synaptic vesicle cycle
ecb04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100069542 (RAB3A)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    100069542 (RAB3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100069542 (RAB3A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100069542 (RAB3A)
   04031 GTP-binding proteins [BR:ecb04031]
    100069542 (RAB3A)
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    100069542 (RAB3A)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   100069542 (RAB3A)
GTP-binding proteins [BR:ecb04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    100069542 (RAB3A)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB MMR_HSR1 GTP_EFTU Gtr1_RagA CPT AAA_24 DUF2757 AAA_16 Septin
Other DBs
NCBI-GeneID: 100069542
NCBI-ProteinID: XP_001503278
Ensembl: ENSECAG00000023115
VGNC: 22117
UniProt: F6VA27
Position
21
AA seq 220 aa
MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFK
VKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQI
KTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLV
DVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcgtctgccacagactcgcgctatgggcagaaggagtcctcggaccagaacttcgac
tacatgttcaaaatcctcatcatcggcaacagcagcgtgggcaagacgtccttcctcttc
cgctacgcagacgactccttcacccccgccttcgtcagcactgtgggcatcgacttcaag
gtcaagaccatctaccgcaacgacaagaggatcaagctgcagatctgggacacagcaggg
caagagcggtaccggaccatcaccacagcctactaccggggagccatgggcttcatcctc
atgtacgacatcaccaacgaggagtcctttaacgccgtgcaggactggtcaacccagatc
aagacctactcgtgggacaatgcccaggtgctgctggtggggaacaagtgcgacatggag
gacgagcgggtggtatcatcagaacgtggccggcagctggctgaccacctggggttcgag
ttctttgaggcaagtgctaaggacaacattaatgtcaagcagacctttgagcgcctggtg
gacgtcatctgtgagaagatgtccgagtcgttggacacggctgaccccgcagtcacgggc
gccaagcagggcccccagctcacggaccagcaggcgcccccgcaccaggactgcgcctgc
tga

DBGET integrated database retrieval system