KEGG   Equus caballus (horse): 100069953Help
Entry
100069953         CDS       T01058                                 

Gene name
SLC27A2
Definition
(RefSeq) very long-chain acyl-CoA synthetase
  KO
K08746  solute carrier family 27 (fatty acid transporter), member 2 [EC:6.2.1.- 6.2.1.3]
Organism
ecb  Equus caballus (horse)
Pathway
ecb03320  PPAR signaling pathway
ecb04146  Peroxisome
ecb04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100069953 (SLC27A2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100069953 (SLC27A2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100069953 (SLC27A2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecb01004]
    100069953 (SLC27A2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecb02000]
    100069953 (SLC27A2)
Enzymes [BR:ecb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     100069953 (SLC27A2)
    6.2.1.-  
     100069953 (SLC27A2)
Lipid biosynthesis proteins [BR:ecb01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   100069953 (SLC27A2)
Transporters [BR:ecb02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   100069953 (SLC27A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 100069953
NCBI-ProteinID: XP_001502057
Ensembl: ENSECAG00000024288
VGNC: 23131
UniProt: F6WIN6
Position
1
AA seq 620 aa AA seqDB search
MLPAIYTALAGLLLLPLLVNLCCPYLFQDLGYFLRVAGVARRARSCERRRPVRTILHGFL
EKVRQTPHKPFVLFRDETFTYAQVDRRSNQVARALHDHVGLRQGDCVAIFMGNEPTYLWL
WLGLMKLGCPMACLNYNIRAKSLLHCFQCCGAKVLLVSPELQEAIEEVLPSLKKDDVSVY
YVSRTSNTDGIDSLLDKVDEVSTEPIPESWRSEVTFSTPALYIYTSGTTGLPKAAMINHR
RLWHATGLAVSSGIKKDDVIYTTLPLYHSAGLMIGANGCMVIGATIVLRIKFSASQFWDD
CRKYNVTVIQYIGELIRYLCNSPQKPNDRDHKVRLALGNGLRGDVWREFIKRFGDIDIQE
FYAATEGNVAFTNYTRKIGAVGRVNYLLRKIINYELIKYDVEKDEPVRDANGYCIKVPKG
EVGLLIGRITQLAPFSGYAGGKAQTEKKKLRDVFKKGDVYFNTGDLLMIDQENFIHFHDR
VGDTFRWKGENVATTEVADIIGLVDFVQEANVYGVPVPGHEGRIGMASIKLKEDREFDGK
KFFKHVVDYLPSYARPRFLRIQDTIEVTGTFKHRKMTLVEEGFNPAVIKDALYFLEDKAE
MYVPLTEDIYNAIYGNTLKL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccgccatctacacggccctggcggggctgctgctcctgccgctgctagtgaac
ctctgctgcccctacctcttccaggacctgggctacttcctgcgggtggccggcgtggcc
cggcgggcgcgcagctgcgagcggcgccgaccggtgcgcaccatcctgcatggcttcctg
gagaaggtgcgccagacgccgcacaagcctttcgtgctcttccgcgacgagacgttcacc
tacgctcaggtggaccggcgcagcaaccaggtggcgcgggcactgcacgaccacgtcggc
ctgcgccagggcgactgcgtggcgatcttcatgggcaatgaaccgacctacttgtggctg
tggctggggctgatgaagctaggctgtcccatggcgtgcctcaactacaacatccgcgcc
aagtccctgttgcactgtttccagtgctgcggagcgaaggtcctacttgtctcgccagaa
ttacaagaagctattgaagaggtgctgccaagcctgaaaaaagatgatgtgtctgtttat
tatgtgagcagaacttctaacacagatgggatcgactctttgctggacaaggtggatgaa
gtgtcgacggaacccattccagaatcgtggaggtcggaagtcactttctccactcctgcc
ttgtacatttatacttctggaaccacaggtctcccaaaagctgcaatgatcaatcatcgt
cgcttatggcatgcaaccggcctggctgtttcaagcgggattaagaaagatgacgtcatc
tataccactttacccttgtaccacagtgctgggctgatgatcggcgcaaatggatgtatg
gtgattggtgctactattgtcttgcggatcaaattttctgccagccagttttgggatgac
tgcagaaagtataacgtcactgtcattcagtacatcggggaactgattcggtatttatgc
aactcaccccagaaaccaaatgatcgtgatcataaagtgagactggcattgggaaatggc
ttgcgaggagatgtgtggagagaatttattaagagatttggagacattgacattcaggag
ttctatgctgccaccgaaggcaatgtcgcctttacgaattatacaagaaaaattggtgct
gttggaagagtaaactacctactgaggaaaatcataaattatgaactgattaaatatgat
gtggagaaagatgaacctgtccgagatgcaaatggatattgcatcaaagttcccaaaggt
gaagttggactcctgattggcagaattacacaactggcaccatttagcggctatgctgga
ggaaaggctcagacagagaagaaaaaactgagagatgtctttaagaaaggagacgtctat
ttcaacactggagatctcttaatgattgaccaagaaaatttcatccacttccacgacaga
gttggagatacattccggtggaaaggggaaaacgtggccaccactgaagtcgctgacata
ataggactggttgattttgtccaagaagcgaatgtttatggagtacctgtgccaggtcac
gaaggtcgaattggcatggcctcgatcaaactaaaggaagaccgtgaatttgatggaaag
aaattctttaagcatgttgtcgattacctgcccagttatgcaaggcccaggtttctaaga
atacaggacaccattgaggtcacgggaacttttaaacaccgcaaaatgaccctcgtggag
gagggctttaaccctgccgtcatcaaagatgccttgtatttcttggaagacaaagcagaa
atgtatgtgcctttgactgaggacatttacaatgccatatatggtaacactctgaaactc
tga

DBGET integrated database retrieval system