KEGG   Equus caballus (horse): 100070489
Entry
100070489         CDS       T01058                                 

Gene name
HACD2
Definition
(RefSeq) very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00062  Fatty acid elongation
ecb01040  Biosynthesis of unsaturated fatty acids
ecb01100  Metabolic pathways
ecb01212  Fatty acid metabolism
Module
ecb_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100070489 (HACD2)
   01040 Biosynthesis of unsaturated fatty acids
    100070489 (HACD2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecb01004]
    100070489 (HACD2)
Enzymes [BR:ecb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     100070489 (HACD2)
Lipid biosynthesis proteins [BR:ecb01004]
 Fatty acid synthase
  Component type
   100070489 (HACD2)
SSDB
Motif
Pfam: PTPLA
Other DBs
NCBI-GeneID: 100070489
NCBI-ProteinID: XP_023479410
Ensembl: ENSECAG00000008612
VGNC: 18678
Position
19
AA seq 254 aa
MAAAAATAATKGNGGGGCRAGGGEAGGARKKRGPGPLATAYLVIYNVVMTAGWLVIAVGL
VRAYLAKGSYHSLYYSIEKPLKFFQTGALLEIIHCAVGIVPSSVVLTSFQVMSRVFLIWA
VTHSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGV
SGELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPLFPQLYFHMIHQR
RKVLSHTEEHKKFE
NT seq 765 nt   +upstreamnt  +downstreamnt
atggcggcggccgcggcgactgcagcgacgaaggggaatgggggcggcgggtgccgggcc
gggggtggcgaagctggcggcgcgcggaagaagaggggccctgggcccttggccacggcg
tacctggtcatctacaatgtggtgatgacggccgggtggctcgttatagccgttggtctg
gtcagagcatacctggcgaagggcagctatcacagcctttattattccattgaaaagcct
ttgaaattcttccaaactggtgccttattggagattatacattgtgcagtaggaattgtt
ccatcttctgttgtcctgacttctttccaggtgatgtcaagagtttttctaatatgggca
gtaacgcatagcgtcaaagaggtgcagagtgaagacagtgtcctcctgtttgtcattgcc
tggaccatcacagaaattatccgttattccttttatacgttcagtctgttaaaccacctg
ccttacctcatcaaatgggccaggtacacgcttttcattgtgctgtaccccatgggagtg
tcgggagagctgctcaccatctacgctgccttgccctttgtcagacaggccggcctgtac
tccatcagtttacccaacaagtacaacttctcctttgactattacgcattcctcattctg
ataatgatctcctacattccactttttccccagttatacttccacatgatacaccagaga
agaaaggtcctttctcatactgaagaacacaagaaatttgaatag

DBGET integrated database retrieval system