KEGG   Equus caballus (horse): 100070907
Entry
100070907         CDS       T01058                                 

Symbol
EPX
Name
(RefSeq) eosinophil peroxidase
  KO
K10788  eosinophil peroxidase [EC:1.11.1.7]
Organism
ecb  Equus caballus (horse)
Pathway
ecb05310  Asthma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100070907 (EPX)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     100070907 (EPX)
SSDB
Motif
Pfam: An_peroxidase
Other DBs
NCBI-GeneID: 100070907
NCBI-ProteinID: XP_005597567
Ensembl: ENSECAG00000017317
VGNC: 17642
UniProt: F6RBT1
Position
11:32756249..32766630
AA seq 715 aa
MKLLLTLAGVLAALILAQLCEGTAPASPRAVETSVLRGCITEAKLLVDAAYNQTQRSMKQ
RLRSGLASPMDLLSYFKRPAAATRTVVRAADYMHVALGLLEEKLQLQGSRSFNVTDVLTE
PQLRLLSQATGCALQDQAEKCSNKYRTITGRCNNKKRPWLGASNQPLARWLPAEYEDRLS
LPFGWTPGKKRNGFPLPLVRAVSNQIVRFPSERLTSDRGRALMFMQWGQFIDHDLDFSPE
SPARVAFTAGVDCEKTCAQLPPCFPIKIPRNDPRIKNQSDCIPFFRSAPACPQNKNKVRN
QINALTSFVDASMVYGSEVSLAQRLRNQTNYFGLLAVNQQFRDNGRDLLPFDNMRNDPCR
LTNRNARIPCFLAGDSRSTETPKLAALHTLFMREHNRLATELRRLNPRWTGDKLYQEARK
IVGAMVQIITYRDFLPLVLGKARARKTLGPYRGYCSNVDPRVANVFTLAFRFGHTMLQPF
MFRLDSQYRASAPNSRVPLSSAFFASWRIVHEGGIDPILRGLMATPAKLNRQDSMLVDEL
RERLFRQVRRIGLDLAALNMQRSRDHGLPGYNAWRRFCRLSQPRNLAQLSRVLKNQALAR
KFLNLYGTPDNIDIWVGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQKRGVFTK
RQRKALRRVSLSRIVCDNTGITTVSRHIFKANTHPRGFVSCRSIPKLDLSAWRGK
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgaagctgctcctgaccctggcaggtgtcctagctgcactcatcctggcccagctctgt
gagggcactgccccagcctcccccagggcagtggagacctcggtccttcggggctgcata
acagaggccaagttgctggtggatgcggcctacaatcagactcagaggagcatgaagcag
cgccttcgcagtggattggccagccccatggacctgctctcctacttcaaacgaccagca
gcggccaccaggacagtcgttcgggctgccgattatatgcatgtggccttggggctgctg
gaggagaagttacaactccaggggtccagatccttcaatgtcactgatgtgctaacagaa
ccccagctgcggctgctgtcccaggccactggctgtgctctccaggaccaggccgagaag
tgcagtaacaaatatcgcaccatcaccgggagatgcaacaacaagaagagaccctggctg
ggggcctccaatcagcccctggctcgctggctgccagctgagtatgaggataggctgtcg
ctccccttcggctggacccccggcaagaagcgcaatggcttccccctccctcttgtccgg
gccgtctccaaccagatcgtgcgcttccccagtgagaggctgacttccgacaggggccgg
gccctcatgttcatgcagtggggccagttcattgaccacgacttggacttctcccctgag
tccccagccagagtggccttcactgcgggcgtcgactgtgagaagacctgcgcccagctg
cccccctgcttccccatcaagatcccacgcaatgaccctcgcatcaagaaccagagtgac
tgtatccctttcttccgctcggcacccgcatgcccccaaaacaagaacaaagtccgaaac
cagatcaacgctctcacctcttttgtggatgccagcatggtgtacggcagcgaggtctcc
cttgcccagcggctccgcaaccaaaccaactactttgggctgctggctgtcaaccaacag
ttccgtgacaatggccgggacctgctgcccttcgacaatatgcgcaacgacccctgtcgc
ctcaccaaccgcaatgcgcgcatcccctgtttcttggcaggtgactcccgatcaactgaa
acccccaaactggcagcgctgcacactctctttatgcgagagcacaaccggctggctacc
gagctgagacgcctgaatccccggtggaccggggacaagctgtaccaggaggctcggaag
atcgtgggggccatggtccagatcatcacctaccgagactttctgcccctggttctgggc
aaggcccgggccaggaaaaccctggggccctatcgggggtactgctccaacgtggacccc
cgtgtggccaatgttttcaccctggccttccgctttggccacaccatgctccagcccttc
atgttccgcttggacagccagtaccgggcctcagcacccaactcgcgtgtcccgcttagc
tccgccttctttgccagctggcgaatcgtgcatgaaggtggcatcgaccccatcctccga
ggcctcatggctacccctgccaagctgaaccgccaagattccatgttagtggatgaactc
cgggagaggctatttcggcaagtgagaagaatcgggctggacctggcagctctcaacatg
caacgcagccgggaccatggcctcccaggatacaatgcctggaggcgcttctgcaggctc
tcccagccccggaatctggctcagcttagccgggtgctgaaaaaccaggctttggcaagg
aagttcctgaatctgtatgggacacctgacaacattgacatctgggttggggccatcgca
gaacctcttctgccaggggcccgagtggggcctcttctggcttgtctctttgagaaccag
ttcagaagagcccgagatggggacaggttctggtggcagaaacggggtgttttcaccaag
agacagcgcaaggccctgagacgggtttccttgtctcgaattgtgtgtgacaataccggg
atcaccaccgtttcgaggcacatcttcaaggccaacacccacccccggggctttgtgagc
tgcaggagcatccccaagttggacctgtcagcctggcgaggcaaatga

DBGET integrated database retrieval system