KEGG   Equus caballus (horse): 100071025Help
Entry
100071025         CDS       T01058                                 

Gene name
PLA2G4D
Definition
(RefSeq) cytosolic phospholipase A2 delta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00564  Glycerophospholipid metabolism
ecb00565  Ether lipid metabolism
ecb00590  Arachidonic acid metabolism
ecb00591  Linoleic acid metabolism
ecb00592  alpha-Linolenic acid metabolism
ecb01100  Metabolic pathways
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04217  Necroptosis
ecb04270  Vascular smooth muscle contraction
ecb04370  VEGF signaling pathway
ecb04611  Platelet activation
ecb04664  Fc epsilon RI signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04724  Glutamatergic synapse
ecb04726  Serotonergic synapse
ecb04730  Long-term depression
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04912  GnRH signaling pathway
ecb04913  Ovarian steroidogenesis
ecb04921  Oxytocin signaling pathway
ecb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100071025 (PLA2G4D)
   00565 Ether lipid metabolism
    100071025 (PLA2G4D)
   00590 Arachidonic acid metabolism
    100071025 (PLA2G4D)
   00591 Linoleic acid metabolism
    100071025 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    100071025 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100071025 (PLA2G4D)
   04010 MAPK signaling pathway
    100071025 (PLA2G4D)
   04370 VEGF signaling pathway
    100071025 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    100071025 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100071025 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100071025 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    100071025 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    100071025 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100071025 (PLA2G4D)
   04913 Ovarian steroidogenesis
    100071025 (PLA2G4D)
   04921 Oxytocin signaling pathway
    100071025 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100071025 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    100071025 (PLA2G4D)
   04726 Serotonergic synapse
    100071025 (PLA2G4D)
   04730 Long-term depression
    100071025 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100071025 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100071025 (PLA2G4D)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100071025 (PLA2G4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cPLA2_C2 PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 100071025
NCBI-ProteinID: XP_023475183
Ensembl: ENSECAG00000006962
VGNC: 21514
Position
1
AA seq 817 aa AA seqDB search
MERLTPREPLGHPHQGEASACWRLTVKVLEARSLGWADLLSEADPYVILQLPTAPGTKFR
TKTVTNSSHPIWNESFSFLIQSQVKNVLELSIYDEDSVTEDETCFKVLYDVSEVLPGQLL
RKTFSLCPQGQEELDVEFLMEETSDRPESLITNNVLVARELSCLDVRLDSTRSTALVADQ
DKLELELVLKGSYEDTQTAALDTASAFCFHYMAAQEAELSGRLRSSESNGWNSDSSAGHL
TVPLRSLAVGKEVTIDLPATNVPGVRLQLKTEDCPKEVAVHLSFDLCAEEKAFLSRRKRV
AARALKQALQLEGDLQEHEVPVVGIMATGGGARAMTSLYGHLLALQKLGLLDCVTYFGGV
SGSTWTMAHLYGDPEWSQRDLEGPIRHAREHLAKSKLDAFSPERLESYRRELELRAEQGH
PVTFVDLWALALEAMLHGQVMDQKLSGQRAALERGQNPLPLYLSLNVKENNLGTFDFKEW
VEFSPYEVGFLKYGAFVPSELFGSEFFMGRLMRRLPESRICFLEGIWSNIFSLNLLDAWY
DLTSSGDDWRQHIKDKIRDLEEPSASSRTSSRPETSWLQPGTALAQAFKGFLTNRPLHQH
SSNFLRGLQLHQDYCGQKAFSTWADCQRDSTPGQLTPWERQLCLVDAGFFLNTSCPAMLR
PGRRLDLILSFDYSLSSPFEVLQHTELYCRGQGLPFPHVEPSPQDQHQPRECHLFLDPTC
PDAPVLLHFPLVNASFKDHSAPGVQRSPAQLPAGQVDLTGATSPYSLFNMTYKEEDFDRL
LQLSDYNVRNSQGAILQALRTALKHRALGARLPGAQT
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggagagactgacacccagggaaccacttggccatcctcaccagggggaggcctctgcc
tgctggcggctcaccgtgaaggtcctggaggcgcggagcctgggctgggctgacctgttg
agcgaggcagacccctatgtgatcctacagctgccaaccgcacctggaacgaagtttagg
accaaaacagtcaccaactccagtcatcccatatggaacgagagcttcagtttcctaatc
cagagtcaggtcaagaatgttctggagctgagcatctatgacgaggactcagtcacagag
gatgagacctgcttcaaggttctctatgacgtctcagaagtcctccctggccagcttctc
cggaagaccttctccctgtgtccccaggggcaggaggagctggatgtggagttcctgatg
gaagaaacgtcagaccgcccagaaagcctcatcaccaacaacgtccttgtggcccgggag
ctatcatgcctggatgtccgtctggacagcacaaggagcacggctcttgtcgcagatcag
gataagctggagctggagctggtgctgaaggggtcatatgaggacacacagacggctgct
ctggacacagcctctgccttctgcttccactacatggcggctcaagaggcagagctgagc
gggcgcctgaggagctcggaaagcaatggctggaactcagacagctcagcagggcacctc
acagtgcccctgaggtccttggctgtggggaaggaggtgaccattgaccttcctgctaca
aatgtcccaggagtgaggctgcagctcaagactgaggactgccccaaggaggtggccgtg
cacctgagcttcgacctgtgtgcggaggagaaagccttcctgagcaggaggaagcgggtg
gcggccagggccctgaagcaggccctgcagctggaaggggacctgcaggagcacgaggtc
cccgtcgtgggcatcatggccacaggaggaggcgctcgggccatgacctctctctacggc
cacctgttggccttgcagaagctgggcctcctggactgcgtgacctacttcgggggcgtc
tcgggctctacatggacaatggcccacctctacggggaccctgagtggtcgcagagagac
cttgagggacccatcagacacgcccgagagcacctggccaagagcaagctggacgccttc
tccccagagcgcctggagagctaccggcgggagctggagctccgggcggagcagggccac
cccgtgaccttcgtggacctgtgggctctggcgctggaggccatgctgcacggccaggtg
atggatcagaagctgtcaggacagagagctgcactggagcggggccaaaaccccctgccc
ctctacttgagcctcaatgtcaaagagaacaatctggggaccttcgacttcaaggagtgg
gttgagttctccccctatgaggtcgggttcctgaagtacggtgccttcgtcccctccgag
ctctttggctctgagttcttcatggggcggctgatgaggagactccctgagtcccggatc
tgctttctggaaggtatctggagcaacattttctccctgaacttgctggatgcctggtat
gacctcaccagctctggtgacgactggagacagcatatcaaggacaagatcagggaccta
gaggagccctctgcctcctcaaggacctcctcaaggccagagacctcttggctgcagcct
ggaacagcactggcccaggcgtttaagggcttcctgaccaacaggccgctccaccagcac
agctccaacttcctccggggcctccagctgcaccaggactactgtggccagaaagccttc
tccacctgggcggactgccagcgagactccacccctggccaactgaccccatgggagcgc
cagctctgcctcgtggatgccggcttctttctcaacactagctgtcccgccatgctccgg
ccaggccgcaggctggacctcatactctcctttgactactccctatcctcgccctttgag
gtgctgcagcacacagagctgtactgccggggccaggggctgccgttcccccacgtggag
cccagccctcaggaccagcaccagcccagggagtgccacctcttcttggaccccacctgc
cctgatgcccctgtcctcctgcacttcccgcttgtcaatgcctccttcaaggaccactcg
gcccctggtgtccagcgcagtcctgcacagctcccggccggccaggtggacctcactggg
gctacctcaccctattccctgttcaacatgacctacaaggaggaagactttgaccgcctg
ctgcagctcagtgactacaacgtacggaacagccagggtgccatcctgcaggccttgagg
accgctctgaagcaccgggccctgggggccaggcttccaggggcacagacttga

DBGET integrated database retrieval system