KEGG   Equus caballus (horse): 100071210
Entry
100071210         CDS       T01058                                 

Gene name
GTF3C2
Definition
(RefSeq) general transcription factor 3C polypeptide 2 isoform X1
  KO
K15200  general transcription factor 3C polypeptide 2
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ecb03021]
    100071210 (GTF3C2)
Transcription machinery [BR:ecb03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     100071210 (GTF3C2)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 100071210
NCBI-ProteinID: XP_003363073
Ensembl: ENSECAG00000014356
VGNC: 18645
Position
15
AA seq 911 aa
MDACGVGCAALGEAGPVGNMTVVDSPREEVLNQFDIKASSETTSAKASIEMSLPTPLPGF
EDSLNEKRLPPKQESLSRLEQQDLPSEMSKVSKPRASKPGRKRGGRTRKGPKRPQQPNPP
SAPLVPGLLDQSNPLSTPMPKKRGRKSKAELLLLKLSKGLDQPESPPPKRPPEDFETPPG
ERPRRRAAQVALLYLQELAEELSTALPAPVSCPESPKVSSPTKPKKSRQQGACQGGEEED
DTAQDEDFVLQVEAEDGEESEAPSESSSEPEPAVPRSIPRGPTSGKQKPHCRGVAPNGLP
NHIMAPVWKCLHLTKDHREQKHSYWEFAEWIPLAWKWHLLSELEAAPYLPQEEKSPLFSV
QREGLPEDGTLYRINRFSSITAHPERWDVSFFTGGPLWALDWCPVPEGAAASQYVALFSS
PDMNETHPLSQLHSGPGLLQLWGLGTLQQESCPGNRAHFVYGIACDHGCIWDLKFCPSGA
WELPGTPRKAPLLPRLGLLALACSDGKVLLFSLPHPEALLAQQPLDAVKPAIYKAQCVAT
LQVGSVQASDPSECGQCLSLAWMPTRPHHHLAAGYYNGMVVFWNLPTNSPLQRIRLSDGS
LKLYPFQCFLAHDQAVRTLQWCKANSHFLVSAGSDRKIKFWDLRRPYEPINSIKRFLSTE
LAWLLPYNGVTVAQDNCYASFGLCGIHYIDAGYLGFKAYFTAPRKGTVWSLSGSDWLGTI
AAGDISGELIAAILPDMALNPINVKRPVERRFPIYKADLMPYQDSPEGQDHSCASSGTPN
PPKARTYAETVNHHYLLFQDTDLSSFHGLLHREPMLRMQEGEGHSKLYLDRLQLEAIHKV
RFSPNLDSYGWLVSGGQSGLVRIHFVRGLTSPLGHRMQLESRAHFSAMFQPSSPTKGPDF
PLTSHCLLPSP
NT seq 2736 nt   +upstreamnt  +downstreamnt
atggatgcctgcggggtcggctgtgctgcccttggggaggccggccccgtggggaacatg
actgtggtagactctcccagagaagaggtgctaaaccagtttgacatcaaggcctcttca
gaaacaaccagtgcaaaggcttccatagagatgtcgttacctacccctttacctggattt
gaggattctcttaatgagaagaggctccctccaaaacaggaaagcctttccagactggaa
cagcaagatcttccttcagagatgtcaaaggtctcaaagcctagggcctcaaagcctggc
cggaagagaggtggtaggacacggaaaggcccaaaaaggccccaacaacctaatcctcca
tcagcccctctggttcctggtctcttagatcaatccaaccctctatccacccccatgcct
aagaaacgaggtcgaaagtccaaggcagagctgctactgctgaagttgtcaaaaggccta
gatcagccagaatctccacctccaaagaggccccctgaggactttgagacccctcctggg
gaacgaccccgccgaagggctgcccaagtggcacttctatatctccaggaactggctgaa
gagctctcaacagccctgcctgctccagtgtcctgtcctgagagccccaaggtgagcagc
cctaccaaaccgaagaaaagccgccagcagggagcctgtcaaggtggagaagaagaggat
gatactgcacaggacgaagactttgttctccaggttgaggctgaagatggagaagaaagt
gaggccccaagtgagagctcttccgagcccgagcctgcagtgcctcgaagcatcccacga
ggacctacttcagggaagcagaagccacactgccggggagtggctcctaatggcttacca
aatcacatcatggctcctgtttggaagtgcctccatctcaccaaggaccaccgagaacag
aaacattcatactgggagtttgcagaatggattcctttagcctggaagtggcacttgtta
tctgaacttgaggcagctccctacctgccgcaggaggagaagtctccactgttttctgta
caacgtgaaggacttcctgaagatggcacactctaccgaataaacagatttagctctatc
acagcacacccagagcgctgggatgtgtccttcttcacggggggaccactctgggctctg
gactggtgccctgtgccagagggggcagcagcctctcagtatgtggcccttttctccagc
cctgacatgaatgagacacacccactgagccagcttcattcgggtcctgggctgctccag
ctctggggccttgggaccttgcagcaagaaagctgtcctggcaacagggcccactttgtc
tatgggattgcgtgtgaccatggctgcatctgggacctcaaattctgccccagtggagca
tgggagcttccaggcacccctcggaaggctcctctcctgcctcggttgggtctcttggct
cttgcctgctcagatgggaaggtgctgctgttcagtcttccccatcctgaggccctgctg
gctcagcagccactagatgcagtgaagcccgccatctataaggcacaatgtgtggcaacc
cttcaggtggggtctgtgcaagcttcggacccctccgagtgtggtcagtgccttagcctg
gcctggatgcccacccggccccaccaccacctggctgctggatactataatggcatggtg
gttttctggaaccttcccactaactcacccctgcagcggatacggctctctgatggttcc
ttgaagctctaccccttccagtgtttcctagcccatgaccaggctgtgcgtacccttcaa
tggtgcaaagctaacagtcatttcctagtctctgcggggagtgaccggaaaatcaaattc
tgggaccttcgacgaccttatgaaccaataaactctatcaagcgcttcttgagtacagag
ctcgcctggcttctcccctataatggtgtcactgtggctcaggacaactgctatgcctct
tttggactctgtggaattcattatattgatgctggttaccttggtttcaaggcctacttt
actgctcctcgaaaaggcaccgtctggagtctttcaggatccgactggcttgggacaata
gccgcaggagatatatccggagagctcattgcagctatattgcctgatatggcactgaac
ccaataaatgtcaagcgacctgtagagcgaagattccctatatataaagcagatctgatg
ccatatcaggacagtcctgaaggtcaagaccactcttgtgcttcatctgggacccctaac
cctcccaaggctcgaacttatgctgaaactgtcaaccatcactacttgctctttcaagac
acagatttgagttcattccatggtctgctccatagagaaccaatgctgcgcatgcaggag
ggagaggggcattcaaagctctacctggacaggctgcagctagaggctattcacaaggta
cgtttcagcccaaacctggactcctatggatggctggtatctggggggcagtcggggctg
gttcggatccattttgtccgtggactcacctccccactgggccaccgtatgcagcttgaa
agccgagcccacttcagtgctatgttccaaccatcctcccctactaaagggcctgacttc
cctctaaccagccactgccttctgcccagtccctag

DBGET integrated database retrieval system