KEGG   Equus caballus (horse): 100071654Help
Entry
100071654         CDS       T01058                                 

Gene name
CAMK2A
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04012  ErbB signaling pathway
ecb04020  Calcium signaling pathway
ecb04024  cAMP signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04114  Oocyte meiosis
ecb04217  Necroptosis
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04310  Wnt signaling pathway
ecb04360  Axon guidance
ecb04713  Circadian entrainment
ecb04720  Long-term potentiation
ecb04722  Neurotrophin signaling pathway
ecb04725  Cholinergic synapse
ecb04728  Dopaminergic synapse
ecb04740  Olfactory transduction
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04916  Melanogenesis
ecb04921  Oxytocin signaling pathway
ecb04922  Glucagon signaling pathway
ecb04925  Aldosterone synthesis and secretion
ecb04934  Cushing syndrome
ecb04971  Gastric acid secretion
ecb05031  Amphetamine addiction
ecb05152  Tuberculosis
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05214  Glioma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100071654 (CAMK2A)
   04310 Wnt signaling pathway
    100071654 (CAMK2A)
   04066 HIF-1 signaling pathway
    100071654 (CAMK2A)
   04020 Calcium signaling pathway
    100071654 (CAMK2A)
   04024 cAMP signaling pathway
    100071654 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100071654 (CAMK2A)
   04217 Necroptosis
    100071654 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100071654 (CAMK2A)
   04922 Glucagon signaling pathway
    100071654 (CAMK2A)
   04912 GnRH signaling pathway
    100071654 (CAMK2A)
   04921 Oxytocin signaling pathway
    100071654 (CAMK2A)
   04916 Melanogenesis
    100071654 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    100071654 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100071654 (CAMK2A)
  09154 Digestive system
   04971 Gastric acid secretion
    100071654 (CAMK2A)
  09156 Nervous system
   04725 Cholinergic synapse
    100071654 (CAMK2A)
   04728 Dopaminergic synapse
    100071654 (CAMK2A)
   04720 Long-term potentiation
    100071654 (CAMK2A)
   04722 Neurotrophin signaling pathway
    100071654 (CAMK2A)
  09157 Sensory system
   04740 Olfactory transduction
    100071654 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    100071654 (CAMK2A)
  09158 Development and regeneration
   04360 Axon guidance
    100071654 (CAMK2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100071654 (CAMK2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100071654 (CAMK2A)
   05205 Proteoglycans in cancer
    100071654 (CAMK2A)
  09162 Cancer: specific types
   05214 Glioma
    100071654 (CAMK2A)
  09165 Substance dependence
   05031 Amphetamine addiction
    100071654 (CAMK2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100071654 (CAMK2A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100071654 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100071654 (CAMK2A)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100071654 (CAMK2A)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100071654 (CAMK2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 APH Kdo SnoaL_2 SnoaL_4
Motif
Other DBs
NCBI-GeneID: 100071654
NCBI-ProteinID: XP_005599354
Ensembl: ENSECAG00000019790
VGNC: 16021
UniProt: F7CJA9
Position
14
AA seq 489 aa AA seqDB search
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKNDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP
VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHR
SGAPSVLPH
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggccaccatcacctgcacacgcttcacggaagagtaccagctctttgaggaactggga
aagggagccttctcagtggtgcgcaggtgtgtgaaggtgctggctggccaggagtatgct
gccaagatcatcaacaccaagaagctttcagccagagaccatcagaagctggagcgcgaa
gcccgcatctgccgcctgctgaagcaccccaacattgtccggctccacgacagcatctct
gaggagggccaccattacctgatcttcgacctggtcactggcggggagctgtttgaggac
atcgtggcccgggagtattacagcgaggcggatgccagtcactgtatccagcagatcctg
gaggccgtgttgcattgccaccagatgggggtggtgcaccgggacctgaagccggagaat
ctgttgctggcctccaagctcaagggcgccgcagtgaagctggcggactttggcctggcc
attgaggtggagggggagcagcaggcgtggttcgggttcgcagggacacctggatacctc
tccccagaagtgctgcggaaggacccttacgggaagccagtggatctgtgggcctgtggg
gtcatcctgtacatcttgctggttgggtaccccccgttctgggatgaagaccagcaccgt
ctgtaccaacagatcaaagccggagcctatgatttcccatcaccagaatgggataccgtc
actccagaagccaaggatctgatcaataagatgctgactatcaacccgtccaaacgtatc
acggccgccgaggcgctcaagcacccatggatctcgcaccggtccaccgtggcctcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaacgccaggagaaaactgaag
ggggccatcctcaccactatgctggccaccaggaacttctctggagggaagagtggagga
aacaagaagaacgatggtgtgaagaaaagaaagtccagttccagcgttcagttaatggaa
tcttcagagagcaccaacaccaccattgaagatgaagacaccaaagtgcggaaacaggaa
attataaaagtgacagagcaactgattgaagccataagcaatggagattttgagtcctac
acgaagatgtgtgaccctgggatgacggcatttgaacccgaggctctggggaacctggtc
gagggcctggacttccatcgattctattttgaaaacctgtggtcccggaacagcaagcct
gtgcacaccaccatcctgaatccccacatccacctgatgggcgacgagtcagcctgcatc
gcctacatccgcatcacgcagtacctggacgcgggcggcatcccccgcacggcccagtca
gaggagacccgcgtctggcaccgcagggacggcaaatggcagatcgtccacttccacaga
tctggggcaccctccgtcttgccccattga

DBGET integrated database retrieval system