KEGG   Equus caballus (horse): 100073097Help
Entry
100073097         CDS       T01058                                 

Gene name
ENPP1
Definition
(RefSeq) ectonucleotide pyrophosphatase/phosphodiesterase family member 1 isoform X1
  KO
K01513  ectonucleotide pyrophosphatase/phosphodiesterase family member 1/3 [EC:3.1.4.1 3.6.1.9]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00230  Purine metabolism
ecb00240  Pyrimidine metabolism
ecb00500  Starch and sucrose metabolism
ecb00740  Riboflavin metabolism
ecb00760  Nicotinate and nicotinamide metabolism
ecb00770  Pantothenate and CoA biosynthesis
ecb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100073097 (ENPP1)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100073097 (ENPP1)
   00240 Pyrimidine metabolism
    100073097 (ENPP1)
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    100073097 (ENPP1)
   00760 Nicotinate and nicotinamide metabolism
    100073097 (ENPP1)
   00770 Pantothenate and CoA biosynthesis
    100073097 (ENPP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ecb04090]
    100073097 (ENPP1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecb00537]
    100073097 (ENPP1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     100073097 (ENPP1)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.9  nucleotide diphosphatase
     100073097 (ENPP1)
CD molecules [BR:ecb04090]
 Proteins
  100073097 (ENPP1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecb00537]
 Enzymes
  100073097 (ENPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphodiest Somatomedin_B Endonuclease_NS Sulfatase Metalloenzyme Bystin
Motif
Other DBs
NCBI-GeneID: 100073097
NCBI-ProteinID: XP_023506867
Ensembl: ENSECAG00000013035
VGNC: 17591
Position
10
AA seq 942 aa AA seqDB search
MERDGCAGGGSHGGGCEGGRGSREDPAGNGRDPSRGHASPAPGDPQAAASLLAPMDVGEE
PLEKAARAGAAKDPNTYKVLSLVLSVCVLTVILGCIFGLKPSCAKEVKSCKGRCFERTFG
NCRCDSACADLGNCCLDYQETCIEPERIWTCSKFRCGEKRLSRSLCSCSDDCRDKDDCCI
NYSSACLGEKSWVQETCENINEPQCPAGFEMPPTLLFSLDGFRAEYLHTWGGLLPVINKL
KTCGTYAKNMRPVYPTKTFPNHYSIVTGLYPESHGIIDNKMYDPKMNASFALKSKEKFNP
KWYKGEPIWLTAKYQGLKAGTFFWPGSDVKINGLFPDIYKIYNGSVPFEERILAVLKWLQ
LPKDERPHFYTLYLEEPDSSGHSHGPVSSEVIRALQRVDNMVGMLMDGLKGLNLHRCLNL
ILISDHGMEQASCKKYAHLDKYLGDVKDIKLVYGPAARLRPSDVPDKYYSFNYEGLARNL
SCRELNQHFKPYLKHFLPKRLHFAKNDRIEPLTFYLDPQWQLALNPPAEKHCQGGFHGSD
NVFSNMQALFIGYGPGFQHGAEVDSFENIEVYNLMCDLLNLIPASNNGTHGSLNHLLKNP
IYTPTHPKEVSSLVQCPFTRTPRNNLGCSCNPSILPIVDLQTQLNLTMAEENIIKRGTLP
YGRPRVIQKNSTVCLLYQHQFVSGYSHDILMPLWTSYTVDRNDIFSTEDFSNCLYQDLRV
SLSPVHECSFYKNNAKLSYGFLSPPQLNKGSSKINSEALLTTNIVPMYQSFQVIWHYFHG
TLLQRYAQERNGVNVVSGPVFDSDFDGRYDSSETLKQNSRRVRNQEVLIPTHFFIVLTSC
KDPDQAPSQCENLDASAFILPHRTDNSESCVMCLHSGASPQKRKQQSASADISLTEILSA
VSEVLSSFSISTVPKAVVPISEIQTFYQVLYDSVPRICTSVG
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgacggctgcgcggggggcgggagccacggtggcggctgtgagggagggcgc
ggctcccgggaggacccggcggggaacggccgcgacccgagccgcggccacgcgtccccg
gcgcccggggacccgcaggcggccgcgtccctgctggcccccatggacgtgggggaggag
ccgctggagaaggcggcgcgcgccggcgcggccaaggaccccaacacctacaaagtgctc
tcgctggtattgtcagtctgtgtgctaacagtaatccttggttgtatatttgggttgaaa
ccaagctgtgccaaagaagttaaaagttgcaaaggtcgctgttttgagaggacatttggg
aactgtcgctgtgattctgcttgtgctgaccttgggaactgctgtctggattaccaggag
acgtgcatagaaccagaacgtatatggacgtgcagcaaattcaggtgtggtgagaaaagg
ttgtccagaagcctttgctcctgttcggatgactgcagggacaaagatgactgttgcatc
aactacagctctgcatgtctaggtgagaaaagttgggtacaagaaacatgtgagaacatt
aatgagccacagtgtccagcagggtttgaaatgcctcctaccctcttattttctttggat
ggtttcagggcagaatatttacacacttggggtggacttcttcctgttatcaacaaactg
aaaacctgtggaacttatgctaaaaacatgagaccagtgtatccaacaaaaactttcccc
aatcactacagcattgtcacaggactttatccagaatcccacggcataattgacaataaa
atgtacgatcccaaaatgaacgcttcttttgcacttaaaagtaaagaaaaatttaatcct
aagtggtacaaaggagaaccaatttggctcacagctaaatatcaaggcctgaaggctggc
acgtttttttggccaggatcggatgtgaaaatcaatggacttttcccagacatttataaa
atatataatggttcagtaccatttgaagaaagaattttagcagttcttaagtggctgcag
cttcctaaggatgaaagaccccacttttacactctgtatttagaagaaccagattcttca
ggtcattcgcatggacccgtcagcagtgaagtcatcagagctttgcagagggtggacaac
atggtcggcatgctgatggatggtctaaaggggctgaacctgcatcgatgcctgaacctg
attcttatttcagatcatggcatggaacaagccagttgtaagaaatatgcgcacctggat
aaatatttgggagatgttaaagatattaaacttgtatatggaccagcagctcgactgaga
ccctctgatgttccagataaatactattcgtttaactatgaaggccttgccagaaatctt
tcttgccgggaactaaaccagcacttcaagccttacctgaaacatttcctacccaagcgt
ttgcactttgccaaaaatgacaggattgagcccttgacgttctatttggaccctcagtgg
cagctggcattgaatcctccggcagagaaacattgtcaaggtggatttcatggctctgac
aacgtattttcaaatatgcaagccctcttcattggctatggacctggatttcaacatggt
gctgaagtggactcctttgaaaatattgaagtttataacttaatgtgcgatttactgaat
ttgataccagcttccaataatggaactcatggcagtcttaaccaccttctaaagaatccc
atttacactccaacacatcccaaagaagtcagctccttggtacagtgccccttcacaaga
acccccagaaataaccttggctgctcgtgcaatccctcaattttgccaattgtggatttg
cagacacagttgaatctgaccatggcagaagagaatatcattaagcgtggcactctaccc
tatggaagacccagagttatccagaagaacagcaccgtctgtcttctttaccaacaccag
tttgtgagtggttacagccatgacatcctaatgcccctttggacgtcctacaccgtcgac
agaaatgacatcttctctacagaagacttttccaactgtctttaccaggatcttcgagtt
tctcttagtcctgtccatgaatgttcattttataaaaataatgctaaactaagctatggg
ttcctctccccgccacaactaaataaaggttcaagtaaaataaattctgaagcattgctt
actactaatatagtgccaatgtaccagagtttccaagttatctggcactactttcatggc
accctactgcaaaggtacgcccaagaaagaaatggcgtcaatgttgtcagcggtcccgtc
tttgactctgattttgatggacgttatgattcctcagagactctgaaacagaacagcaga
cgcgtccgtaatcaggaggttctgatcccaactcacttcttcattgtgctgacaagttgt
aaagatccagaccaggctccctcacagtgtgaaaatttagatgcgtcagctttcattttg
cctcacaggacagacaacagtgagagctgtgtgatgtgtctgcactctggggcctcccct
caaaaaagaaagcagcaatcggcttctgctgacatctcattgaccgaaattctaagtgcc
gtgagtgaagtgttgagttccttttccatctctaccgttccaaaagctgttgtgccaata
tctgaaatacaaacattttatcaagttctatatgacagtgtacctagaatatgtacctca
gtagggtga

DBGET integrated database retrieval system