KEGG   Equus caballus (horse): 100073165Help
Entry
100073165         CDS       T01058                                 

Gene name
ALDH3A2
Definition
(RefSeq) fatty aldehyde dehydrogenase isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00010  Glycolysis / Gluconeogenesis
ecb00053  Ascorbate and aldarate metabolism
ecb00071  Fatty acid degradation
ecb00280  Valine, leucine and isoleucine degradation
ecb00310  Lysine degradation
ecb00330  Arginine and proline metabolism
ecb00340  Histidine metabolism
ecb00380  Tryptophan metabolism
ecb00410  beta-Alanine metabolism
ecb00561  Glycerolipid metabolism
ecb00620  Pyruvate metabolism
ecb01100  Metabolic pathways
Module
ecb_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100073165 (ALDH3A2)
   00053 Ascorbate and aldarate metabolism
    100073165 (ALDH3A2)
   00620 Pyruvate metabolism
    100073165 (ALDH3A2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100073165 (ALDH3A2)
   00561 Glycerolipid metabolism
    100073165 (ALDH3A2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100073165 (ALDH3A2)
   00310 Lysine degradation
    100073165 (ALDH3A2)
   00330 Arginine and proline metabolism
    100073165 (ALDH3A2)
   00340 Histidine metabolism
    100073165 (ALDH3A2)
   00380 Tryptophan metabolism
    100073165 (ALDH3A2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100073165 (ALDH3A2)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100073165 (ALDH3A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC PT-HINT
Motif
Other DBs
NCBI-GeneID: 100073165
NCBI-ProteinID: XP_001503562
Ensembl: ENSECAG00000011403
VGNC: 15235
Position
11
AA seq 524 aa AA seqDB search
MEHQVQRVRDAFLSGRSRPLRFRLQQLEALRRMLQEREKDIVAAIGADLRKSEFNAYVQE
FLTLLGEIDLVLEKLPEWVKATPAKKNMLIMLDEAYIQPQPLGVVLIIGAWNYPLVLLIQ
PLIGAIAAGNAVIMKPSEVSENTAKILAKLLPQYLDQDLYVVVNGGIEETTELLKQQFDH
ILYTGNTMVGKIIMEAAAKHLTPVTLELGGKSPCYVDRDCDLDVACRRIAWGKYMNCGQT
CVAPDYILCESSLQNQIVQKVKETLKEFYGENIKESPDYERIINLRHFKRILSLLEGQKI
AFGGETDEATRYVAPTVLIDVDPESKVMQEEIFGPILPIVPVKNAEEAIRFINEREKPLA
FYVFSHNDKLVKRMIEGTSSGAVTVNDVVVHFMLSSLPFGGVGSSGMGAYHGKHSFDTFS
HQRSCLLRNFKREFVNKLRYPPSSQSKVDWAKFVLLKQFSKGKLCLLLLAFLGAVVAVLV
KKYQAVLRRKALLIFLAVHRLCCPMNSRFQAPALLRVRLDTSEE
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggagcaccaagtccagcgggttcgcgatgccttcctgtccggccggtcgcgaccgctg
aggttccggctgcagcagctggaggccctgcgcaggatgttgcaggagcgcgagaaggac
atcgtggcggccatcggcgccgacctgcgcaagagcgaattcaatgcatacgttcaggaa
ttccttactcttcttggggagattgaccttgtgctggagaagcttcctgaatgggttaag
gctacaccagctaagaagaacatgctcatcatgctggatgaggcctacattcagccacag
ccactgggagttgtactgattattggagcttggaactacccccttgttctcctcattcaa
cctctgataggagccattgctgcaggaaatgctgtgattatgaagccttctgaagtaagt
gaaaatacagccaagatcttggctaagctgctccctcagtatttagaccaggacctgtat
gttgttgttaatggtggcatcgaggagaccacagaacttctcaagcagcaatttgaccac
attttatatacgggaaacactatggttggaaaaattatcatggaagctgctgccaaacat
ctgacccctgtgactcttgaacttgggggtaagagtccgtgctacgttgacagagactgt
gacctggatgtcgcctgcagacgcatcgcctgggggaagtacatgaattgcggccaaacc
tgcgttgctcctgactacatcctctgtgagtcatccctccagaatcaaatcgtgcagaag
gtgaaggagaccttgaaggaattttatggagaaaatataaaagaatctcctgattatgaa
aggatcatcaatcttcgtcactttaagaggatactaagtttgcttgaaggacaaaagata
gcttttggtggagagaccgatgaagccacacgctatgtagccccaacggtacttattgat
gttgatcctgaaagcaaggtgatgcaagaagaaatttttggaccaattcttccaatagtg
cctgtaaagaatgcagaggaggccataagattcataaatgaacgtgaaaagcccctggct
ttctatgtattttctcataacgataagctcgtcaaacggatgattgagggcacatccagc
ggcgccgtcacagtcaacgacgtcgtagtgcacttcatgctcagctcgttaccctttgga
ggagtgggttcaagtgggatgggagcttatcatggaaaacacagttttgatactttttct
catcaacgttcctgtttattaagaaattttaagagagaatttgttaacaaactcagatac
cctcccagcagccagtcaaaggtggactgggccaaatttgtcttattaaaacagttcagc
aaaggaaaactctgtctcctgttactcgctttcctgggcgctgtggtggctgtgctggtc
aagaaataccaagctgtgctgaggagaaaggccctgttgatttttctggcagttcacaga
ctgtgttgtccaatgaacagcagatttcaagccccagctttgttaagagtgaggctggat
acttctgaagaatga

DBGET integrated database retrieval system