KEGG   Equus caballus (horse): 100073224
Entry
100073224         CDS       T01058                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1 precursor
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecb01002]
    100073224 (ERAP1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100073224 (ERAP1)
Peptidases and inhibitors [BR:ecb01002]
 Metallo peptidases
  Family M1
   100073224 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF1570
Other DBs
NCBI-GeneID: 100073224
NCBI-ProteinID: NP_001296210
Ensembl: ENSECAG00000003636
VGNC: 17646
UniProt: F7BLK5
Position
14
AA seq 942 aa
MVSLSIKWPLASMSFLLSSLMILFTVSTPSWCQRSKTISPKASDGTPFPWDKMRLPERVI
PVHYNLMIHANLTTLTFEGTTEVEIRASQPTSAIILHSHHLQISRATLRKGAGERQSEKP
LRVLEYPSHEQIALLAPEPLVVGLPYTVVIDYAGNLSETFHGFYKSTYRTKEGEVRILAS
THFEPTAARMAFPCFDEPAFKASFSVKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVT
VKMSTYLVAFIISDFKSVSKMTKSGVKVSIYAVPDKINQADYALDTAVTLLEFYEDYFNI
PYPLPKQDLAAIPDFESGAMENWGLTTYRESSLLFDAEKSSVSSKLGITMTVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEYVSVSVTHPELKVEDYFLGKCFSAMEVDALNSSHPV
STPVENPAQIREMFDDVSYEKGACILNMLRDYLGADAFKSGVVQYLQKYSYKNTKNEDLW
NSMANICPTDGAQRMDGFCSRGQHSSSSSHWRQEGLDVKTMMNTWTLQKGFPLVTITVRG
RNVHMKQEHYMKGPEDAPDTGYLWHVPLTFITSKSDSVHRFLLKTKTDVLILPEEVEWIK
FNVGMNGYYIVHYEDDGWDSLIDLLKRTHTAISSNDRASLINNAFQLVSIGKVSIEKALD
LILYLKQETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKSFLIRLLRDLIDKQTWTDE
GSVSERMLRSQLLLLACVRKYQPCVQRAEGYFREWKEANGNLSLPSDVTMAVFAVGAQNP
EGWDFLFSKYQSSLSSTEKNRIEFALCMSQNKEKLQWLLDQSFKGDIIKTQEFPDILRSI
GRNPVGYPLAWKFLRENWNKLVQKFELGSPSISYMVMGTTNQFSTRARLEEVKGFFSSLK
ENGSQLRCVQQTIETIEENIRWMDKNFDKIKVWLQNEKLELL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atggtatctctgtccatcaaatggccccttgcaagcatgtcatttctactttcctcactg
atgattcttttcactgtgtcaactccttcctggtgtcagagaagtaaaactatatctcca
aaagctagtgatgggacaccatttccttgggataaaatgcggcttcctgagcgtgtcatc
ccagttcattacaatctcatgatccatgcaaatctcaccactctgactttcgagggaacc
acggaagtagaaatcagggccagccagcccaccagtgccatcatcctgcacagtcaccac
ctgcagatctctagggccaccctgaggaagggagctggagagaggcagtctgaaaagccg
ctgagagtcctggaatacccgtctcatgagcaaatcgcgcttctggctcctgagcctctg
gtcgtggggctcccgtacacagttgtcatcgactatgctggcaatctctctgagactttc
catggattttataaaagcacctacagaaccaaggaaggggaagtgaggatacttgcgtca
acacactttgaacctactgcagccagaatggcctttccctgctttgatgaacctgccttc
aaagcgagtttttcagtcaagatcagaagggagccaaggcacctcgccatctccaacatg
ccgttggttaaatctgtcactgttgctgaaggactcatagaagaccactttgatgtcact
gtgaagatgagcacctacctggtggccttcattatttcagattttaagtctgtcagcaag
atgaccaagagcggagtcaaggtttccatctatgctgtgccagacaagataaaccaggca
gattatgcactggatactgcggtgactcttctagaattttatgaggattatttcaacatt
ccatatcccttacccaaacaagatcttgctgctattcctgactttgagtctggtgctatg
gaaaactggggactgaccacataccgggaatcctctctgttgtttgatgctgaaaagtct
tctgtatcaagtaagcttggcatcacgatgactgtgtcccatgaactcgcccaccagtgg
tttgggaacctcgtcactatggaatggtggaatgatctctggctaaatgagggatttgcc
aagtttatggagtacgtgtctgtcagtgtgacccatccagaactgaaagttgaagattat
ttccttggtaagtgttttagtgcgatggaggttgacgcattaaattcctcacaccctgtg
tccactcctgtggagaatcctgctcagattcgggagatgtttgatgatgtttcctatgaa
aagggagcttgtattcttaatatgctaagggattatcttggtgctgatgcatttaaaagt
ggtgttgtccagtatctccagaagtatagctataaaaacacaaaaaatgaggacctgtgg
aatagcatggcaaatatttgccctacagatggtgcacaaaggatggatggcttttgctct
agaggtcaacattcatcttcatcctcacactggcgacaggagggccttgatgtgaaaacc
atgatgaacacctggacgctgcagaagggctttcccctggtgaccatcacagtgagaggg
aggaacgtacacatgaagcaagagcactatatgaaaggaccagaggatgccccagatact
gggtacctgtggcatgttccgttgacgttcataaccagcaaatcagactcagtccataga
tttttgctgaagacaaaaacagacgtgctcatcctcccagaagaggtggaatggatcaaa
tttaatgtgggaatgaatggctattacattgtgcattacgaagatgatggatgggattct
ctgattgaccttttaaaacgaacacacacagcaatcagcagtaatgatcgggccagtctc
attaataatgcatttcagcttgtcagcattggaaaggtctcgattgaaaaagccctggat
ttaatcctgtacctcaaacaggaaactgaaattatgcctgtgttccaaggtttgaatgag
ctgatacctatgtataagttaatggagaaaagagacatgaatgaagtagaaactcaattc
aagtcctttctcatcaggctgctgagggacctcattgataagcagacttggacggacgag
ggctcagtctcagagcgaatgctgcggagtcagctcctcctccttgcctgtgtgcgcaag
tatcagccctgtgtgcagagggcagaaggctatttcagagagtggaaggaagccaatgga
aatctgagcctgcccagtgacgtgaccatggcagtgtttgctgtgggggcccagaaccct
gaaggatgggattttctttttagtaaatatcagtcatctttgtccagtaccgagaaaaac
cgaattgaatttgccctctgtatgagccaaaacaaggagaagcttcagtggctactagat
caaagttttaagggagatataataaaaactcaagagtttccagatattcttagatctatt
ggcagaaacccagtgggatatccactggcctggaagtttctgagggaaaactggaataaa
cttgtgcaaaagttcgaacttggctcaccttccataagctacatggtcatgggaacaaca
aatcaattctccacaagagcacggcttgaagaggtaaaaggattcttcagctctttgaaa
gaaaatggttctcagcttcgttgtgtccaacaaacaattgaaaccatcgaggaaaatata
cgttggatggataagaattttgataaaatcaaagtgtggctgcaaaatgaaaagcttgaa
ctgctctaa

DBGET integrated database retrieval system