KEGG   Equus caballus (horse): 100073261Help
Entry
100073261         CDS       T01058                                 

Gene name
THBS4
Definition
(RefSeq) thrombospondin-4
  KO
K04659  thrombospondin 2/3/4/5
Organism
ecb  Equus caballus (horse)
Pathway
ecb04145  Phagosome
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb05144  Malaria
ecb05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100073261 (THBS4)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100073261 (THBS4)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100073261 (THBS4)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100073261 (THBS4)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    100073261 (THBS4)
   05144 Malaria
    100073261 (THBS4)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100073261 (THBS4)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100073261 (THBS4)
  Exosomal proteins of colorectal cancer cells
   100073261 (THBS4)
  Exosomal proteins of bladder cancer cells
   100073261 (THBS4)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100073261 (THBS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA cEGF EGF EGF_3
Motif
Other DBs
NCBI-GeneID: 100073261
NCBI-ProteinID: XP_023473862
Ensembl: ENSECAG00000019665
VGNC: 24075
Position
14
AA seq 961 aa AA seqDB search
MRAPRGAALLLLHLALQPWLGAGAQASPHVFDLLPSSSQRLNPAVLKPILTDPTLNELYV
IFTFKLQTRSSATVFGLYSSTDNSKYFEFTVMGRLNKAILRYLKNDGKIHLVAFNNLQLA
DGRRHRVLLRLTNLRRGAGSVDLYLDCKQVDSVHNLPRAFSGLSQNAESVELRTFQRKAQ
DFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATSTGDFNRQFLGQMTQLNQLLGEVKDL
LRQQVKETTFLRNTIAECQACGPLSFQSPTPNTLVPPAPPAPPTPPMRRCDSNPCFRGVR
CTNTRDGFQCGPCPEGYTGNGVTCSDVDECKYHPCYPGVRCVNLAPGFRCDACPVGFSGP
VLQGVGISFAKSNKQVCADIDECRNGACVLNSICVNTLGSYRCGPCKPGYTGDQTRGCKI
ERNCRNPELNPCSVNAQCIEGRQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSAR
NCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGVLNEQDNCVLTHNMDQRNSDKDIFG
DACDNCRNVLNNDQKDTDGDGKGDACDDDMDGDGIKNILDNCPKAPNRDQQDKDGDGVGD
ACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIG
DECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNRDGVGDICETDFDQDQVIDWIDVCP
ENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVD
FEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVK
SQTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYE
GSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRLD
N
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgcgggccccgcgcggagccgcgctcctcctgctgcacctggccctgcagccgtggctg
ggcgccggcgcgcaggcctccccgcacgtctttgaccttctgccatcctccagccagagg
ctgaatcctgctgtcctgaagccaatcctgacagaccccaccctgaacgagctgtatgtg
atcttcaccttcaagctgcagaccaggagctcagccaccgtctttggcctttactcttcg
actgacaacagcaaatattttgaatttactgtgatgggacgattaaacaaagccatcctc
cgctacctgaagaatgatgggaagattcacctggtggctttcaacaacctgcagctggct
gatggcaggcggcacagggtcctcctgagactgaccaacttacggcgaggggctggctct
gtggatctctacctggactgcaagcaagtggattccgttcacaatctccccagagccttt
tctggcctctcccagaatgctgagtccgttgaattgaggactttccagaggaaggcacag
gacttcttggaagagctgaagctggtggtgcgaggctcgctgttccaggtcgccagcctg
caagactgcttcctgcagcagagtgagccgctggccgccacgagcacaggagactttaat
cgtcaattcttggggcaaatgacacaactaaaccagctcctgggagaggtgaaggatctt
ctgagacagcaggtcaaggaaacaacgtttttgcgaaacaccatagctgaatgccaggct
tgcggtcctctcagctttcagtctccgaccccgaacacactggtgccccccgcaccccca
gcacctccgacacccccaatgcgccggtgtgattccaacccatgtttccgtggcgtccgc
tgtaccaacaccagagatggctttcagtgtgggccctgtcccgagggctacacgggaaat
ggggttacctgttctgatgttgatgagtgcaaatatcatccctgctacccgggcgtgcgc
tgcgtgaacttggcgcccggcttcagatgtgacgcctgcccagtgggcttctcagggccg
gtgttgcagggtgttgggatcagttttgccaagtcaaacaagcaggtctgcgctgatatt
gatgagtgtcgaaatggagcatgcgttctcaattccatctgtgttaacactttggggtct
tatcgctgtgggccttgtaaaccagggtacactggcgatcagacaaggggatgcaaaatt
gaaagaaactgcaggaatccagaactgaatccttgcagcgtgaacgcgcagtgcatcgaa
gggaggcagggggatgtgacgtgcgtgtgcggagtcggttgggctggtgatggatacatc
tgtggaaaggatgtggacatcgacagttaccctgatgaggaactgccatgctctgccagg
aactgtaagaaggacaactgcaagtatgtgccaaattctggccaagaagatgcagacaga
gatggcattggagatgcttgtgatgaggatgctgatggagatggggtcctgaatgagcag
gataactgtgtcctgactcacaacatggaccaaaggaacagtgacaaagatatctttggg
gatgcctgtgataactgccggaatgtcctaaataatgaccagaaagacactgatggggat
ggaaaaggggatgcctgtgatgatgacatggatggcgatggaataaaaaacattctggac
aactgccccaaagctcccaatcgtgaccaacaggacaaggatggtgatggcgtgggggat
gcctgcgacagttgtcctgatgtcagcaaccctaaccagtctgatgtggataacgacctg
gttggggactcctgtgacaccaaccaggacagtgacggagacgggcaccaggacagtaca
gacaactgccccactgtcattaacagtgcccagctggacactgacaaggatggaattggt
gacgagtgtgatgatgacgatgacaatgatggcatcccagacctggtgccccctggacca
gacaactgccggctggtccccaacccagcccaggaggatagcaacagagacggtgtggga
gacatctgtgagacagactttgaccaggaccaggtcatcgactggatcgacgtctgccca
gagaacgcggaggtcaccctgaccgacttcagggcctaccagactgtggtcctggaccct
gaaggcgacgcccagatcgatcccaactgggtggtcctgaaccagggcatggagatcgtg
cagaccatgaacagtgaccccggcctggcagtggggtacaccgcttttaatggagttgac
tttgaggggaccttccacgtaaacacccagacggacgatgattatgccggctttatcttt
ggttaccaagacagctccagcttctacgtggtcatgtggaagcagacagagcagacgtat
tggcaggccaccccgttccgagctgttgcagaacctggcattcagcttaaggccgtgaag
tctcagacaggtccaggggagcatctccgcaactccctgtggcacactggggacaccagc
gaccaggtgaggctgctgtggaaggactccaggaacgtgggctggaaggacaaggtatcc
taccgctggttcctgcaacaccggccccaggtgggctacatcagggtacgattttatgaa
ggctccgagttggtggctgactccggggtcaccatcgacaccaccatgcgtggaggccgg
cttggcgtcttctgcttctcccaagaaaacatcatttggtccaacctcaagtatcgctgc
aatgacaccatcccagaggacttccaagagtttcaaacccagaatttcgatcgcctggat
aattaa

DBGET integrated database retrieval system