KEGG   Equus caballus (horse): 100146145Help
Entry
100146145         CDS       T01058                                 

Gene name
GPX2
Definition
(RefSeq) glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00480  Glutathione metabolism
ecb00590  Arachidonic acid metabolism
ecb01100  Metabolic pathways
ecb04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100146145 (GPX2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100146145 (GPX2)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    100146145 (GPX2)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100146145 (GPX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 100146145
NCBI-ProteinID: NP_001159953
Position
24
AA seq 190 aa AA seqDB search
MAYIAKSFYDLSAISLDGEKIDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRR
LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGFQPTFTLVQKCEVNGQNQHPVFAYLK
DKLPYPYDDPLSLMTDPKFIIWSPVCRSDVSWNFEKFLIGPEGEPFRRYSRTFPTINIEP
DIKRLLKVAI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcttacattgctaagtccttctacgaccttagtgctatcagcctggatggggagaag
atagatttcaatacattccgaggcagggcggtgctgattgagaatgtggcctcgctctga
ggcacaactacccgggacttcacccagctcaacgagctgcagtgccgctttcccaggcgc
ctggtggttctcggcttcccgtgcaaccaatttggacatcaggagaactgtcagaatgag
gagatcctgaacagtctcaagtatgtccgccctgggggtggattccagcccacctttacc
cttgtccaaaagtgtgaagtgaatggtcagaaccagcatcctgtcttcgcctacctgaag
gacaagctcccctacccttatgatgacccactttcccttatgaccgatcccaagttcatc
atttggagcccggtgtgccgctcagatgtgtcctggaactttgagaagttccttattggg
ccagagggggagcccttccgacgctacagccgcaccttccccaccatcaacattgagcct
gacatcaagcgcctcctcaaagttgccatatag

DBGET integrated database retrieval system