KEGG   Equus caballus (horse): 100146214Help
Entry
100146214         CDS       T01058                                 

Gene name
HSD17B2
Definition
(RefSeq) estradiol 17-beta-dehydrogenase 2 isoform X2
  KO
K13368  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) [EC:1.1.1.62 1.1.1.239]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00140  Steroid hormone biosynthesis
ecb01100  Metabolic pathways
ecb04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100146214 (HSD17B2)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100146214 (HSD17B2)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     100146214 (HSD17B2)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     100146214 (HSD17B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR Epimerase IcmF-related
Motif
Other DBs
NCBI-GeneID: 100146214
NCBI-ProteinID: XP_014593952
Position
3
AA seq 383 aa AA seqDB search
MSLFCSETVGLCLAVTVVLGGAVLCKLKSPGQEGRKVVCLVGLWGGACLLSLSLFWGLLL
FSLSCCLMYTYLSGQELLPVDQKAVLITGSDSGIGHALSKHLDELGFTVFAGVLDAKGSG
AEELRRSCSKRLSVLQLDITDPQQIKDAYSKVLEKVQNRGLWAVVNNAGIICFPAEGELI
PMTHYKRCMAVNFFGAVEVTKAFLPLLRRSKGRLVSISSMAGVPMEKLAAYGSSKAALTM
FSAVMRRELSKWGIKVSVIQPGGFQTNIAGTSEMQDKLEKNLLDHLTPDVQEDYGQDYIL
AERNFLSVLNVKSQPDVSPVLRDIRHAISAKSPFAFYAPGKESYLFLCFASFVPTCVFDL
FLKNDGQSMPRALRMPNWKNKAM
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttttctgctctgagacagtggggctctgcctggctgtcaccgtagtgctggga
ggagcagttctttgcaaactgaagagcccagggcaggaggggagaaaggtggtctgcttg
gtgggcctgtggggaggggcttgcctgctcagcctgtccctcttctggggcttgcttctc
ttctccctgtcatgttgcctcatgtatacttacttatccggccaagagctgttacctgtg
gatcaaaaggcggtgctgatcacaggtagcgattctgggattggccatgctttgtctaag
catctggatgagctgggcttcacagtatttgccggagttctggatgcaaagggatcagga
gcggaggaattacgaagaagctgctccaagcgcctgtctgtgctccagttggacatcact
gacccgcagcagatcaaagacgcctacagcaaagtcctggagaaggtgcagaacagagga
ctgtgggctgtggtcaacaatgctgggatcatttgcttcccagccgagggggagctcatc
cccatgacccactacaaacgatgcatggctgtgaacttctttggggcagtggaagtcacg
aaggcatttttgcctcttcttaggagatccaaagggaggctggtgagcatcagcagcatg
gcaggggtcccaatggaaaagctggcagcttatgggtcatccaaggcggctctgaccatg
ttttcggcagtcatgagacgagaactttccaaatggggaattaaagtctctgtcatccag
cccggaggcttccaaacaaatatcgcaggcacgagtgaaatgcaggacaagctggagaag
aacctcttggaccacctcaccccggacgtgcaggaagactacggccaggactatatcctc
gcagaacggaattttctcagtgtattgaacgtgaagtctcaaccagatgtctccccggtg
ctccgggacatccggcacgccatctccgctaaaagccccttcgccttttacgcaccgggg
aaggagtcttatctgttcctctgttttgcttcctttgtccctacttgcgtatttgatctt
tttctcaagaacgatggacagagcatgcccagagctctaaggatgcctaactggaagaat
aaggccatgtag

DBGET integrated database retrieval system