KEGG   Equus caballus (horse): 100146256Help
Entry
100146256         CDS       T01058                                 

Gene name
LYPLA1
Definition
(RefSeq) acyl-protein thioesterase 1 isoform X2
  KO
K06128  lysophospholipase I [EC:3.1.1.5]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00564  Glycerophospholipid metabolism
ecb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100146256 (LYPLA1)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    100146256 (LYPLA1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100146256 (LYPLA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Hydrolase_4 Abhydrolase_3 Abhydrolase_1 Cutinase DUF2974 DLH Lipase_3 FSH1 Abhydrolase_6 Esterase AXE1
Motif
Other DBs
NCBI-GeneID: 100146256
NCBI-ProteinID: XP_005613221
Position
9
AA seq 172 aa AA seqDB search
MPVTLNMNMAMPSWFDIVGLSPDSQEDEPGIKQAAENVKALIEQEVKNGIPSHRIILGGF
SQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPISGVNRDISILQCHGDCDPLVP
LMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDIKQFIDKLLPPVD
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaacattaaatatgaacatggctatgccttcttggtttgatattgttggactt
tcaccagattcacaggaggatgaacctggaattaaacaggcagcagaaaatgtaaaagct
ttgatagagcaagaggtgaagaatggcattccttctcacagaattattttgggaggattt
tctcagggaggagctttatctttatacactgctcttactacacagcagaaactggcaggt
gtcactgcactcagctgctggcttccgctgcgggcttcgtttccacagggtcctatcagt
ggagttaatagagatatttctattctccagtgccatggagattgtgacccattagttccc
ctaatgtttggttctcttactgttgaaaagctaaaaacattggtaaatccagccaatgta
accttcaaaacctatgaaggcatgatgcacagttcatgtcaacaggaaatgatggatatc
aagcaattcattgataaactcctacctccggttgattga

DBGET integrated database retrieval system