KEGG   Equus caballus (horse): 100146804Help
Entry
100146804         CDS       T01058                                 

Definition
(RefSeq) glutathione S-transferase A1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00480  Glutathione metabolism
ecb00980  Metabolism of xenobiotics by cytochrome P450
ecb00982  Drug metabolism - cytochrome P450
ecb00983  Drug metabolism - other enzymes
ecb01100  Metabolic pathways
ecb01524  Platinum drug resistance
ecb05200  Pathways in cancer
ecb05204  Chemical carcinogenesis
ecb05225  Hepatocellular carcinoma
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100146804
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100146804
   00982 Drug metabolism - cytochrome P450
    100146804
   00983 Drug metabolism - other enzymes
    100146804
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100146804
   05204 Chemical carcinogenesis
    100146804
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100146804
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100146804
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100146804
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecb02000]
    100146804
Enzymes [BR:ecb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100146804
Transporters [BR:ecb02000]
 Other transporters
  Pores ion channels [TC:1]
   100146804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3
Motif
Other DBs
NCBI-GeneID: 100146804
NCBI-ProteinID: XP_005604131
Position
20
AA seq 174 aa AA seqDB search
MTAKELRSDSAPFSSSLSGKSSGFKALTGSQGLRLYLENPGDCISSEKPRLHYFSTGGQM
ESIQWLLAAAGLEFEEKFVDTLEDFQKLKNDGSLMFQQVPTVEIDGMKLVQSRAILNYIA
TKHNLYGKDIKERAPYGISPALSSTINRNNSGPSLRDQDCVRGITTTSSVASVV
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgacagccaaagagctgaggagtgactctgctcccttctcctcctcgctgtcagggaag
tcctctggtttcaaggccctcacaggctcgcagggcctgcgtctgtatttagagaatcca
ggggactgcatctcgtcagagaagcccaggctgcactacttcagcacaggagggcagatg
gagtcgatccagtggctcctggctgctgctgggctagagtttgaagagaaatttgtagac
actctggaagactttcaaaagttaaaaaatgatgggagtttgatgttccagcaagtgcca
acggtcgaaattgatgggatgaagctggtgcagagcagagccattctcaactacattgcc
accaaacacaacctctatgggaaagacatcaaggagagagccccgtacggtatttctcct
gctctttcatcaacaattaataggaacaattcaggtccttcactaagggaccaagactgt
gtcagggggatcacgaccaccagcagtgtggcctcggtggtatag

DBGET integrated database retrieval system