KEGG   Equus caballus (horse): 100147278Help
Entry
100147278         CDS       T01058                                 

Gene name
DNASE2
Definition
(RefSeq) deoxyribonuclease-2-alpha
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100147278 (DNASE2)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     100147278 (DNASE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNase_II
Motif
Other DBs
NCBI-GeneID: 100147278
NCBI-ProteinID: XP_005611907
Ensembl: ENSECAG00000018970
VGNC: 17248
Position
7
AA seq 342 aa AA seqDB search
MAALSPLVLAALLWVPVGTLTCYGDSGQPVDWFVVYKLPRGLRYKYMDGDSRGWREGADF
INSSAGAVGRSLLPLYRSNASQLAFLLYNDQPPQSSRARDSSSRGHTKGVLLLDRDGGFW
LVHSVPRFPPPAASAAYSWPPTARPYGQTLLCVSFPFDQFKDISRQLNYTFPLVYDYKLE
GDIAQRLPDLVKVAKGLHVRSKPWNSSVTLTSKAGATFQSFVKSRNFGDDLYSGWLAEAL
GSNLQVQFWPHSAGVLRSNCTGLRHVLDVTEIAFPGPSGPAFSNQDDHSKWCVAPERPWA
CVGDMNRNSAEEHRGGGTLCSQLPALWKAFQPLVKAWEPCGP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgctgagcccgctggttctggccgcgctgctgtgggtccctgtggggacactg
acctgctatggggactcggggcagccggtggactggttcgtcgtctacaagctgccgcgg
gggctgcggtacaaatacatggatggggactcaaggggctggcgcgaaggcgcggacttc
atcaacagctcggcgggggccgtgggccgcagcctgctgccgctgtaccggagcaacgcc
agccagctcgccttcctactctacaatgaccagccccctcaatccagccgggctcgggac
tcctccagtcgggggcacacgaagggggtgctgctcctcgaccgagatggaggtttctgg
ctggtccacagcgttccgcgcttccctccacctgccgcctctgctgcatacagctggcca
cctactgcccgcccctacgggcagaccctgctctgcgtgtcttttcccttcgaccagttc
aaggatatcagcagacagctgaactacacttttcccctggtgtacgactacaagctggaa
ggggacatcgcccagaggctccccgacctggtgaaggtagccaagggcctccatgttcgc
agcaaaccctggaacagcagtgtaacactcacatcaaaggcaggggccaccttccagagc
tttgtcaaatccagaaactttggagatgacctctactctggctggttggcagaagccctc
ggcagcaacctgcaggtccagttctggccacattctgctggcgtgctccgctccaactgc
actgggctccggcatgtgctggatgtgactgagatagccttccccgggccaagtgggcca
gccttcagtaaccaagacgaccactccaagtggtgtgtagccccagaaaggccctgggcc
tgtgtcggagacatgaatcggaactccgcagaggagcaccgaggcgggggcacactgtgt
tcccagctgccggccctctggaaggccttccagcctctggtgaaggcctgggagccctgt
gggccatga

DBGET integrated database retrieval system