KEGG   Equus caballus (horse): 100327035
Entry
100327035         CDS       T01058                                 

Gene name
CSN1S2
Definition
(RefSeq) alphaS2-casein precursor
Organism
ecb  Equus caballus (horse)
SSDB
Motif
Pfam: Casein ATPase-cat_bd
Other DBs
NCBI-GeneID: 100327035
NCBI-ProteinID: NP_001164238
UniProt: D2KAS0
Position
3
AA seq 214 aa
MKFFIFTCLLAVALAKHNMEHRSSSEDSVNISQEKFKQEKYVVIPTSKESICSTSCEEAT
RNINEMESAKFPTEREEKEVEEKHHLKQLNKINQFYEKLNFLQYLQALRQPRIVLTPWDQ
TKTGDSPFIPIVNTEQLFTSEEIPKKTVDMESTEVVTEKTELTEEEKNYLKLLYYEKFTL
PQYFKIVRQHQTTMDPRSHRKTNSYQIIPVLRYF
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaagttcttcatttttacctgccttttggctgttgctcttgcaaagcataatatggag
catcgctcctccagcgaggactctgtcaacatctcccaggaaaaatttaagcaggaaaag
tatgtggtcattcctaccagtaaggagagtatttgttccacatcctgtgaggaagccaca
aggaacataaatgaaatggaatctgctaaatttcccacagagagagaagaaaaggaagtg
gaagaaaagcaccacctaaaacaactgaacaaaatcaaccagttttatgagaagttgaac
ttcctccaatatctccaggcccttcgtcaacctcggattgtcctgaccccatgggatcag
actaagacaggggactccccctttattcctattgtgaacacagaacagctcttcaccagt
gaggaaatcccaaagaagactgttgatatggaatcaactgaggtagtcactgagaaaact
gagctgactgaagaagaaaagaattacctaaaacttctgtattatgagaagttcaccttg
ccgcaatatttcaagattgttcgtcaacaccagacaactatggatccacggagtcacaga
aagacaaattcttaccaaattatccctgttctgaggtacttctaa

DBGET integrated database retrieval system