KEGG   Equus caballus (horse): 100629524
Entry
100629524         CDS       T01058                                 

Gene name
CSTA
Definition
(RefSeq) cystatin-A
  KO
K13907  cystatin-A/B
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecb01002]
    100629524 (CSTA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100629524 (CSTA)
Peptidases and inhibitors [BR:ecb01002]
 Peptidase inhibitors
  Family I25: cystatin family
   100629524 (CSTA)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100629524 (CSTA)
SSDB
Motif
Pfam: Cystatin SQAPI Afaf Dynein_light HET-S
Other DBs
NCBI-GeneID: 100629524
NCBI-ProteinID: XP_003363423
Ensembl: ENSECAG00000024043
VGNC: 16918
UniProt: F6YCC0
Position
19
AA seq 102 aa
MMSGGMPGGLTEARPATPEIQEIADRVKPQLEEKTNQTYEEFKAVEYKTQVVAGTNYYIK
VQVGDNNYIHLKIFKSLPQQNESLTLTGYQTDKRKDDELKGF
NT seq 309 nt   +upstreamnt  +downstreamnt
atgatgtctggagggatgcctggagggttaactgaagccagacctgccactccagaaatc
caggagattgctgatagggttaaaccacaacttgaagaaaaaacaaatcagacttatgaa
gaatttaaagctgtggagtataaaactcaagtggttgctggaacaaattactacattaag
gtgcaagtaggtgataataattatattcatctgaaaatattcaaaagtcttcctcaacaa
aatgagtctttgacacttactggttaccagactgacaaaaggaaagacgatgagctgaag
ggcttttag

DBGET integrated database retrieval system