KEGG   Equus caballus (horse): 102149746
Entry
102149746         CDS       T01058                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
ecb  Equus caballus (horse)
Pathway
ecb04080  Neuroactive ligand-receptor interaction
ecb04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102149746 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102149746 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 102149746
NCBI-ProteinID: XP_023489285
Position
X
AA seq 77 aa
MDLRLCVQALLLLWLSLTAVCGGPLLQPPDGQGLEEGDVRYLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atggatctgcggctctgcgtgcaggcgctcctgctgctctggctctccctgacggcggtg
tgcggagggcccctgctgcagcctcctgacgggcaggggctggaggaaggcgatgtccgc
tacctggtgcagcccagagggtcgagaaacggaccagggccctggcagggagggcggagg
aaattccgccgccagcggccgcgcctctcccataagggccccatgcctttctga

DBGET integrated database retrieval system