KEGG   Equus caballus (horse): 807845Help
Entry
807845            CDS       T01058                                 

Gene name
COX2
Definition
(RefSeq) cytochrome c oxidase subunit II
  KO
K02261  cytochrome c oxidase subunit 2
Organism
ecb  Equus caballus (horse)
Pathway
ecb00190  Oxidative phosphorylation
ecb01100  Metabolic pathways
ecb04260  Cardiac muscle contraction
ecb04714  Thermogenesis
ecb04932  Non-alcoholic fatty liver disease (NAFLD)
ecb05010  Alzheimer disease
ecb05012  Parkinson disease
ecb05016  Huntington disease
Module
ecb_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    807845 (COX2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    807845 (COX2)
  09159 Environmental adaptation
   04714 Thermogenesis
    807845 (COX2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    807845 (COX2)
   05012 Parkinson disease
    807845 (COX2)
   05016 Huntington disease
    807845 (COX2)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    807845 (COX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ecb03029]
    807845 (COX2)
Mitochondrial biogenesis [BR:ecb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    807845 (COX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX2 COX2_TM DUF2569
Motif
Other DBs
NCBI-GeneID: 807845
NCBI-ProteinID: NP_007163
UniProt: P48660 A5JYB7
Position
MT
AA seq 227 aa AA seqDB search
MAYPFQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISSMLTTKLTHTSTMDAQE
VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLTFDS
YMIPTSDLKPGELRLLEVDNRVVLPMEMTIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN
QTTLVASRPGLYYGQCSEICGSNHSFMPIVLELVPLKHFEEWSASML
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcctaccccttccaactaggattccaagacgcaacatcccctattatagaagaactc
ctacacttccacgaccacacactaataatcgtattcctaattagctctctagtattatat
attatctcatcaatactaacaactaaattaacccataccagcaccatagatgctcaagaa
gtagagacaatttgaacgattttaccagccatcatccttattctaatcgccctcccatcc
ctacgaattctatatataatagatgaaatcaataatccgtccctcacagtcaaaacaata
ggccaccaatgatactgaagctacgagtataccgattacgaagacttgacctttgactcc
tacatgatccccacatcagacctaaaaccaggagaattacgtcttctagaagtcgacaat
cgagtggttctccccatagaaataaccatccgaatgctaatttcatccgaagacgtccta
cactcatgagctgtgccctccctaggcctaaaaacagacgctatccctgggcgcctaaat
cagacaactctcgtggcctctcgaccaggactttactacggtcaatgctcagagatctgc
ggatcaaaccacagctttataccaattgtccttgaactagttccactgaaacacttcgaa
gaatgatctgcatcaatattataa

DBGET integrated database retrieval system