KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c0532Help
Entry
c0532             CDS       T00106                                 

Gene name
ispA
Definition
(GenBank) Geranyltranstransferase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00900  Terpenoid backbone biosynthesis
ecc01100  Metabolic pathways
ecc01110  Biosynthesis of secondary metabolites
ecc01130  Biosynthesis of antibiotics
Module
ecc_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    c0532 (ispA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ecc01006]
    c0532 (ispA)
Enzymes [BR:ecc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     c0532 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     c0532 (ispA)
Prenyltransferases [BR:ecc01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   c0532 (ispA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt UbiA
Motif
Other DBs
NCBI-ProteinID: AAN79010
UniProt: A0A0H2V4U8
Structure
PDB: 

Position
complement(514130..515029)
Genome map
AA seq 299 aa AA seqDB search
MDFPQQLEACVKQANQALSRFIAPLPFQNTPVVETMQYGALLGGKRLRPFLVYATGHMFG
VSINTLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAGDALQTL
AFSILSDADMPEVSDRDRISMISELASASGIAGMCGGQALDLDAEGKHVPLDALERIHRH
KTGALIRAAVRLGALSAGDKGRNALPVLDKYAESIGLAFQVQDDILDVVGDTATLGKRQG
ADQQLGKSTYPALLGLEQARKKARDLIDDARQSLKQLTEQSLDTSALEALADYIIQRNK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggactttccgcagcaactcgaagcctgcgttaagcaggccaaccaggcgctgagccgt
tttatcgccccactgccctttcagaacactcccgtggtcgaaaccatgcagtatggcgca
ttattaggtggtaagcgcctgcgacctttcctggtttatgccactggtcatatgttcggc
gttagcataaacacactggacgcacccgctgccgccgtagagtgtatccacgcttactca
ttaattcatgatgatttaccggcgatggatgatgacgatctgcgtcgcggtttgccgacc
tgccatgtgaagtttggcgaagcaaacgcgattctcgctggtgacgctttacaaacgctg
gcgttctcgattctaagcgatgccgatatgccggaagtgtcagatcgcgacagaatttcg
atgatttctgagctggcgagcgccagcggtattgccggaatgtgcggtggtcaggcatta
gatttagacgctgaaggcaaacacgtacctctggacgcgcttgagcgtattcatcgtcat
aaaaccggcgcattgattcgcgccgccgttcgccttggtgcattaagcgccggagataaa
ggacgaaatgcactgccagtactcgacaagtacgcagagagcatcggccttgccttccag
gttcaggatgacatcctggatgtggtgggagatactgcaacgttgggaaaacgccagggt
gccgaccagcaacttggtaaaagtacctaccctgcacttctgggtcttgagcaagcccgg
aagaaagcccgggatctgatcgacgatgcccgtcagtcgctgaaacaactgactgaacag
tcactcgatacctcggcactggaagcgctagcggactacatcatccagcgtaataaataa

DBGET integrated database retrieval system