KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c0800Help
Entry
c0800             CDS       T00106                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00020  Citrate cycle (TCA cycle)
ecc00190  Oxidative phosphorylation
ecc00650  Butanoate metabolism
ecc01100  Metabolic pathways
ecc01110  Biosynthesis of secondary metabolites
ecc01120  Microbial metabolism in diverse environments
ecc01130  Biosynthesis of antibiotics
ecc01200  Carbon metabolism
Module
ecc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ecc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    c0800 (sdhD)
   00650 Butanoate metabolism
    c0800 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    c0800 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AAN79273
UniProt: P0AC45
Structure
PDB: 

Position
781885..782232
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgt
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgctaccagt
ggcgagctgacatatgaagtctggattggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggccttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system