KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1092
Entry
c1092             CDS       T00106                                 

Gene name
ycbG
Definition
(GenBank) Hypothetical protein ycbG
  KO
K09911  uncharacterized protein
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    c1092 (ycbG)
SSDB
Motif
Pfam: MatP MatP_C RHH_4 TMF_TATA_bd
Other DBs
NCBI-ProteinID: AAN79560
UniProt: Q8FJ81
Structure
PDB: 
4D8J

Position
1062260..1062712
AA seq 150 aa
MKYQQLENLESGWKWKYLVKKHREGELITRYIEASAAQEAVDELLSLENEPVLVNGWIDK
HMNPELVNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFIVWQRLAGLAQRRGKTLSETIV
QLIEDAENKEKYANKMSSLKQDLQALLGKE
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaaatatcarcaacttgaaaatcttgaaagcggttggaaatggaagtatctggtgaag
aagcaccgcgaaggggagttaatcacccgttacatagaagccagtgccgcccaggaagcc
gtcgatgagttgctctcgctggaaaatgaacccgtgctggtaaatggttggattgacaag
catatgaatccggaactggtcaatcgcatgaagcagaccattcgggccagacggaagcgc
cattttaatgcagaacaccagcatacgcgcaaaaaatcgatcgatctggaatttatcgtc
tggcaacgtctggctggccttgcgcagcgtcgcggtaaaacgctttctgaaacgattgtt
cagctgattgaagatgcggaaaacaaagagaaatacgcgaataaaatgtcttctttgaag
caggatctgcaggcattgctgggtaaggaataa

DBGET integrated database retrieval system