KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1639Help
Entry
c1639             CDS       T00106                                 

Gene name
dadX
Definition
(GenBank) Alanine racemase, catabolic
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00473  D-Alanine metabolism
ecc01100  Metabolic pathways
ecc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    c1639 (dadX)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    c1639 (dadX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ecc01011]
    c1639 (dadX)
Enzymes [BR:ecc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     c1639 (dadX)
Peptidoglycan biosynthesis and degradation proteins [BR:ecc01011]
 Precursor biosynthesis
  Racemase
   c1639 (dadX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AAN80104
UniProt: P59237
Position
1476306..1477376
Genome map
AA seq 356 aa AA seqDB search
MTRPIQASLDLQALKQNLSIVRQAAPYARVWSVVKANAYGHGIERIWSALGATDGFALLN
LEEAITLRERGWKGPILMLEGFFHAQDLEIYDQHRLTTCVHSNWQLKALQNARLKAPLDI
YLKVNSGMNRLGFQPDRVLTVWQQLRAMANVGEMTLMSHFAEAEHPDGISSAMARIEQAA
EGLECRRSLANSAATLWHQEAHFDWVRPGIILYGASPSGQWRDIANTGLRPVMTLSSEII
GVQTLKAGERVGYGGRYTARDEQRIGIVAAGYADGYPRHAPTGTPVLVDGVLTMTVGTVS
MDMLAVDLTPCPQAGIGTPVELWGKEIKIDDVAAAAGTVGYELMCALALRVPVVTV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtccgatacaggccagcctcgatctgcaggcattaaaacagaatctgtccatt
gtccgccaggccgcgccgtacgcgcgcgtctggtcggtggtaaaagcgaacgcttacggg
cacggtattgagcgtatctggagcgcgctcggggccaccgatggctttgcattgcttaat
ctggaagaggcaataacgttacgtgagcgcggctggaaaggaccgatcctgatgctggaa
ggatttttccatgctcaggatctggagatttatgaccagcaccgcctgaccacctgcgta
cacagcaactggcagctcaaagcactgcaaaatgcgcggctaaaagcaccgttggatatt
tatcttaaagtgaacagtgggatgaatcggttgggcttccagcccgatcgcgtgcttacc
gtctggcagcagttgcgggcgatggcgaatgttggcgaaatgaccctgatgtcgcatttt
gccgaagcggaacatcctgatggaatttccagcgcgatggcgcgtattgagcaggcggcg
gaagggctggagtgtcggcgttcgttggccaattcggcggcgactctgtggcaccaggaa
gcgcattttgactgggttcggcctggtattattttgtatggcgcttcgccgtccggtcag
tggcgtgatatcgccaataccggattacgtccggtgatgacgctaagcagtgagattatt
ggtgtccagacgctaaaagcgggcgagcgtgtgggctacggcggtcgctatactgcgcgc
gatgaacagcgaatcggcattgtcgccgcaggatacgccgacggttatccgcgccacgcg
cctaccggtacccctgttttagtggacggcgttctcaccatgacggtggggacagtctcg
atggatatgctggcggtcgatttaacgccttgcccgcaagcgggtattggtacgccagtt
gagctgtggggcaaggagatcaaaattgatgatgtcgccgccgctgccggaacggtaggc
tatgagttgatgtgcgcgctggcgttacgcgtcccggttgtgacggtgtaa

DBGET integrated database retrieval system