KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1803Help
Entry
c1803             CDS       T00106                                 

Gene name
mppA
Definition
(GenBank) Periplasmic murein peptide-binding protein precursor
  KO
K15580  oligopeptide transport system substrate-binding protein
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc01501  beta-Lactam resistance
ecc02010  ABC transporters
ecc02024  Quorum sensing
Module
ecc_M00439  Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    c1803 (mppA)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    c1803 (mppA)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    c1803 (mppA)
Transporters [BR:ecc02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter [MD:M00439]
    c1803 (mppA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5 DUF4038 SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: AAN80267
UniProt: A0A0H2V8B1
Structure
PDB: 

Position
1636492..1638126
Genome map
AA seq 544 aa AA seqDB search
MSVRGKLMKHSVSVTCCALLVSSISLSYAAEVPSGTVLAEKQELVRHIKDEPASLDPAKA
VGLPEIQVIRDLFEGLVNQNEKGEIVPGVATQWKSNDNRIWTFTLRDNAKWADGTPVTAQ
DFVYSWQRLVDPKTLSPFAWFAALAGINNAQAIIDGKAAPDQLGVTAVDAHTLKIQLDKP
LPWFVNLTANFAFFPVQKANVESSKEWTKPGNLIGNGAYVLKERVVNEKLVVVPNTHYWD
NAKTVLQKVTFLPINQESAATKRFLAGDIDITESFPKNMYQKLLKDIPGQVYTPPQLGTY
YYAFNTQKGPTADQRVRLALSMTIDRRLMTEKVLGTGEKPAWHFTPDVTAGFTPEPSPFE
QMSQEELNAQAKTLLSAAGYGPQKPLKLTLLYNTSENHQKIAIAVASMWKKNLGVDVKLQ
NQEWKTYIDSRNTGNFDVIRASWVGDYNEPSTFLTLLTSTHSGNISRFNNPAYDKVLAQA
STENTVKARNADYNAAEKILMEQAPIAPIYQYTNGRLIKPWLKGYPINNPEDVAYSRTMY
IVKH
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttagagggaaacttatgaagcactctgtttcagtcacgtgttgtgcgctgttg
gtcagcagcatttctctttcgtatgctgctgaagttccgagcggcacagtactggcagag
aagcaggagctggtgcgccacattaaagatgagccagcgtcgctggatcccgctaaagcc
gtgggcctgccggagattcaggtcattcgcgatctgtttgaaggactggtgaatcagaac
gagaaaggggagattgtccccggcgttgcgactcagtggaaaagtaatgacaaccgtatc
tggacttttaccctgcgcgataacgcaaaatgggcggatggcacaccggtaacggcgcaa
gattttgtctacagctggcaacgtctggtggacccgaaaacgctatcgccatttgcatgg
tttgccgcgctggcgggaatcaacaacgcacaggcgattattgatggtaaagccgcgcct
gaccagcttggcgtcaccgcagttgatgcccatactttgaaaatccagcttgataaacca
ttgccgtggtttgtgaatttaaccgctaactttgccttcttcccggtgcaaaaagccaac
gtagaaagcagtaaagagtggacgaaacccggaaatctgatcggcaatggcgcttatgtt
cttaaagagcgcgtagtcaatgaaaaactggtcgtggtgccgaatacccattattgggat
aacgccaaaacggtactgcaaaaagtgaccttcctgccaattaatcaggaatccgcagcc
actaagcgttttctcgcgggggatattgatatcaccgaatccttcccgaaaaatatgtat
cagaagctgttgaaggatattccggggcaggtttatacgccgccgcagctcgggacctat
tattatgcgtttaacacgcaaaaagggccgacggcagatcagcgcgttcgcctggcatta
agtatgacgatagatcgccgcctgatgaccgaaaaagtgttggggacgggcgaaaagcca
gcgtggcattttacaccagatgttaccgcgggatttacgccggaaccttcgccgtttgaa
caaatgagtcaggaagaactgaatgcgcaggcaaaaactttgttgagcgccgctggttat
ggtccgcaaaaaccgctgaagctgacgcttttgtataacacttcagaaaaccatcaaaaa
attgcgattgctgtagcatcgatgtggaaaaagaacctgggcgtagatgttaaattgcaa
aaccaggaatggaaaacctatatcgatagccgtaataccggcaattttgatgttatccgc
gcctcgtgggtaggggattataatgaaccctccactttcctgacattattaacgtcaacg
cattccgggaatatttcacgctttaacaatccggcatatgacaaagttctggcccaggca
tcgacggaaaataccgttaaagcgcgtaatgccgattacaacgcggcagaaaaaatcctc
atggagcaagcaccgattgcaccaatttatcaatataccaatggacgattaatcaagccg
tggctgaaaggttatcccattaataaccctgaagatgtggcgtacagtcggactatgtat
attgtgaagcattaa

DBGET integrated database retrieval system