KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1916Help
Entry
c1916             CDS       T00106                                 

Gene name
osmC
Definition
(GenBank) Osmotically inducible protein C
  KO
K04063  osmotically inducible protein OsmC
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    c1916 (osmC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OsmC
Motif
Other DBs
NCBI-ProteinID: AAN80375
UniProt: A0A0H2V7B8
Structure
PDB: 

Position
1749589..1750020
Genome map
AA seq 143 aa AA seqDB search
MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGEKGTNPEELIGAAHAACF
SMALSLMLGEAGFTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGIDASTFDVIIQK
AKAGCPVSQVLKAEITLDYQLKS
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgacaatccataagaaaggtcaggcacactgggaaggcgatatcaaacgcgggaaggga
acagtatctactgagagcggcgtgctgaaccaacagccgtatggatttaacacgcgtttt
gaaggcgaaaaaggaaccaaccctgaagaactgattggcgcagcgcatgccgcatgtttc
tcaatggcgctttcattaatgctgggggaagcgggattcacgccaacatcgattgatacc
accgccgatgtctcgctggataaagtggatgccggttttgcgattactaaaatcgcactg
aagagcgaagttgcggtgccgggtattgatgcctccacctttgacgtcattatccagaaa
gcaaaagcaggatgcccggtttctcaggtactgaaagcggaaattacgctggattaccag
ttgaaatcgtaa

DBGET integrated database retrieval system