KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1918Help
Entry
c1918             CDS       T00106                                 

Definition
(GenBank) Putative sensor kinase
  KO
K13243  c-di-GMP-specific phosphodiesterase [EC:3.1.4.52]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    c1918
Enzymes [BR:ecc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.52  cyclic-guanylate-specific phosphodiesterase
     c1918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAS_9 PAS PAS_4 PAS_8 PAS_3 GGDEF PAS_7 PAS_10
Motif
Other DBs
NCBI-ProteinID: AAN80376
UniProt: A0A0H2V7L6
Structure
PDB: 

Position
complement(1751294..1752634)
Genome map
AA seq 446 aa AA seqDB search
MRQDAEVIMKLTDADNAADGIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEV
IGNNIDMLIPRDLRPAHPQYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSA
EGKVYYLALVRDASVEMAQKEQTRQLIIAVDHLDRPVIVLDPERHIVQCNRAFTEMFGYC
INEASGMQPDTLLNIPEFPADNRIRLQQLLWKTARDQDEFLLLTRTGEKIWIKASISPVY
DVLAHLQNLVMTFSDITEERQIRQLEGNILAAMCSSPPFHEMGEIICRNIECVLNESHVS
LFALRNGMPIHWASSSHGAEVQNAQSWSATIRQRDGAPAGILQIKTSSGAETSAFIERVA
DISQHMAALALEQEKSRQHIEQLIQFDPMTGLPNRNNLHNYLDDLVDKAVSPVVYLIGVD
HIQDVIDSLGYAWADQALLEVVNRFL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgcgccaggatgcagaggtaatcatgaagctaaccgatgcggataatgccgccgatggc
atttttttccccgcccttgagcaaaacatgatgggcgcggtgttaattaacgaaaatgat
gaagtgatgtttttcaaccccgcagcagagaagctctgggggtacaaacgtgaagaagtc
attggcaataacattgatatgctgattccgcgggatttgcgtcctgcgcatcctcaatac
attcgtcacaaccgtgaaggtggtaaagcgcgcgtcgaggggatgagtcgggagctgcag
ctggagaaaaaagacggcagtaaaatctggacccgttttgcgctatcgaaagtgagcgcc
gaggggaaagtttattacctggcgctggtacgggatgccagcgtagaaatggcgcaaaaa
gaacagacccgacaattgattattgccgttgaccatctcgaccgaccggtgattgtcctc
gatccggaacgccatattgtgcagtgcaatcgcgcatttaccgaaatgtttggttactgc
attaacgaagccagcggtatgcagcccgatacactcctgaacattccagaattccctgct
gataaccgtattcgtttacaacagttgctatggaaaaccgcccgcgatcaggacgaattt
ctgctgttgacgcgcaccggtgaaaaaatctggattaaagcctctatcagcccggtttat
gacgtgctcgcgcatctgcagaacctggtaatgacattctcggatatcaccgaagaaagg
caaatccgccagcttgaaggcaatattctcgccgccatgtgcagcagccccccatttcat
gaaatgggggaaatcatttgtcgtaacatcgaatgtgttctcaacgaatcgcatgtttcg
ctgttcgcgctgcgcaacgggatgccgatacactgggcgtcatcttcgcacggtgcagaa
gttcaaaatgcgcaaagctggtcagcgaccattcgtcagcgcgatggcgcgcctgcgggg
atcctgcaaattaaaacctcgtcaggagcagaaaccagcgcctttatcgaacgcgtggca
gatatcagccagcatatggccgcgctggcgctggaacaggaaaaaagccgtcagcatatt
gaacaactcatccaatttgatccgatgaccggtttgccaaatcgcaataacctgcacaat
tacctcgatgacctggtcgacaaagccgtctctccggtggtgtatctcatcggtgttgac
catattcaggatgtgattgatagccttggctatgcgtgggccgatcaggcattgctggaa
gtggtcaatcgctttctgtga

DBGET integrated database retrieval system