KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1925Help
Entry
c1925             CDS       T00106                                 

Gene name
yddA
Definition
(GenBank) Hypothetical ABC transporter ATP-binding protein yddA
  KO
K02471  vitamin B12/bleomycin/antimicrobial peptide transport system ATP-binding/permease protein
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    c1925 (yddA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecc02000]
    c1925 (yddA)
Transporters [BR:ecc02000]
 ABC Transporters, Eukaryotic Type
  Other subfamilies
   Other ABC transporters
    c1925 (yddA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane_2 SbmA_BacA ABC_tran AAA_21 SMC_N NACHT AAA_30 RsgA_GTPase AAA_16 TsaE cobW AAA_29 MRP-S32 DUF3487
Motif
Other DBs
NCBI-ProteinID: AAN80383
UniProt: A0A0H2V7C3
Position
complement(1763329..1765014)
Genome map
AA seq 561 aa AA seqDB search
MITIPITFCMLIAKYLCLLKPFWLRKNNKTSVLLIIIILAMILGVVKIQVWLNDWNNDFF
NALSQKETDKLWQLVLWFPALLGIFVLISVNKTWLIKLLTIRWREWLTDYYLNRWFADKN
YYFTQIYGEHKNTDNPDQRIAEDILLLISKTLSLSFGFIQSLSMLITFTVILWQSAGTLS
FTVGGTEWSIQGYMVYTVVLIVIGGTLFTHKVGKRIRPLNVEKQRSEATFRTNLVQHNKQ
AELIALSNAESLQRQELSENFHTIKENWHRLMNRQRWLDYWQNIYSRSLSVLPYFLLLPQ
FISGQINLGGLMKSRQAFMLVSNNLSWFIYKYDELAELAAVIDRLYEFHQLTEQRPTNKP
KNCQHAVQVADASIRTPDNKIILENLNFHVSPGKWLLLKGYSGAGKTTLLKTLSHCWPWF
KGDISSPADSWYVSQTPLIKTGLLKEIICKALPLSVDDKSLSEVLHQVGLGKLAARIHDH
DRWGDILSSGEKQRIALARLILRRPKWIFLDETTSHLEEQEAIRLLRLVREKLPTSGVIM
VTHQPGVWNLVDDICDISAVI
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgataaccattcccattacgttttgtatgttgatagcaaagtatctctgtctgctgaag
cccttttggctgcgtaagaataataaaacttcagtgttgttaatcattattatcctcgcc
atgatccttggcgtggttaaaattcaggtctggttaaacgactggaataatgattttttc
aatgcgctaagccagaaagaaactgataagctttggcagcttgtcctttggttccctgcc
ctgctggggatctttgtattaatatccgtaaacaaaacatggttaattaaactactgact
attcgctggcgcgaatggttaacagattactaccttaatcgctggtttgcagataaaaac
tactacttcacgcagatctacggcgagcataaaaatacagataaccctgaccaacgtatc
gctgaagacattctcttactgatcagcaaaacgctcagcctttcatttggcttcatccag
tcacttagcatgctgatcacctttaccgttattctttggcaaagcgcgggtacgctctca
ttcactgttggtggaactgaatggagtatccaggggtatatggtctataccgtcgtgctc
attgtgatcggtggaactttatttacccataaggttggtaaacgtattcgtccacttaat
gtggaaaaacaacgtagcgaagcgacatttcgaactaatcttgtgcagcataataagcag
gcagaactgattgcgctaagcaatgctgagtctctacaacgccaggagttgagcgaaaat
tttcataccattaaagagaactggcatcgtttaatgaatcgtcagcggtggcttgattac
tggcagaatatttattcgcgctcgcttagcgttcttccctactttctgttattgccgcag
tttattagcggacagatcaatctgggcggactgatgaaatcgcgccaggcatttatgctg
gtatcgaacaatttaagctggtttatttataaatatgatgaacttgctgaactggctgcg
gttatcgatcgcttgtatgagttccatcaactcaccgaacagcgccctacgaataagcct
aaaaattgtcaacatgcggtacaagtggctgacgcgagtattcgtactcctgataataag
atcatattagagaacctgaactttcatgtttcgccaggcaaatggctattgctgaaaggt
tactctggtgcgggaaaaaccacactgcttaaaacattatcccactgctggccgtggttt
aaaggtgatatttcttctcctgctgacagttggtatgtgtcacaaacaccgttaatcaaa
accggcttactgaaagagattatttgtaaagcacttcccctgtccgtagacgataaatcg
ttgagcgaagtactgcatcaggttggtctggggaaattggctgcgcgtattcatgatcac
gatcgctggggagatattctttccagcggcgaaaaacaacgtatcgccctggctcgatta
attttacgacgtccgaaatggatatttcttgacgaaactacctctcatcttgaggaacaa
gaggcaatccgcttactgcgtttagtgcgagaaaaactccccacaagcggcgtcattatg
gttacacatcaacccggtgtctggaacctggtcgatgatatttgtgacattagcgcggtt
atataa

DBGET integrated database retrieval system