KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1948Help
Entry
c1948             CDS       T00106                                 

Gene name
yneI
Definition
(GenBank) Aldehyde-dehydrogenase like protein yneI
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00250  Alanine, aspartate and glutamate metabolism
ecc00650  Butanoate metabolism
ecc00760  Nicotinate and nicotinamide metabolism
ecc01100  Metabolic pathways
ecc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    c1948 (yneI)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    c1948 (yneI)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    c1948 (yneI)
Enzymes [BR:ecc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     c1948 (yneI)
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     c1948 (yneI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AAN80405
UniProt: A0A0H2V7D8
Position
complement(1790223..1791635)
Genome map
AA seq 470 aa AA seqDB search
MTHKGDTPMTITPATHAISINPATGEQLSVLPWAGVDDIENALQLAAAGFRDWREANIDY
RAEKLRDIGKALRARSEEMAQMITREMGKPINQARAEVAKSANLCDWYAEHGPAMLKAEP
TLVENQQAVIEYRPLGTILAIMPWNFPLWQVMRGAVPIILAGNGYLLKHAPNVMGCAQLI
AQVFKDAGIPQGVYGWLNADNDGVSLMIKDSRIAAVTVTGSVRAGAAIGAQAGAALKKCV
LELGGSDPFIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIIEEGIASAFTERFVAAA
AALKMGDPRDEENALGPMARFDLRDELHHQVEKTLAQGARLLLGGEKMAGAGNYYPPTVL
ANVTPEMTAFREEMFGPVAAITIAKDAEHALELANDSEFGLSATIFTTDETQARQMAARL
ECGGVFINGYCASDARVAFGGVKKSGFGRELSHFGLHEFCNIQTVWKDRI
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgactcataaaggagataccccgatgaccattactccggcaactcatgcaatttcgata
aatcctgccaccggtgaacaactttctgtgctgccgtgggctggtgttgacgatatcgaa
aacgcgcttcagctggcagcagcaggctttcgcgactggcgcgaggcaaatatagattat
cgtgctgaaaaactgcgtgatatcggtaaggctctgcgcgcccgtagcgaagaaatggcg
caaatgatcacccgtgaaatgggcaaaccaatcaaccaggcgcgcgctgaagtggcgaaa
tcggcgaatttgtgtgactggtatgcagaacatggtccagcaatgctgaaagcggaacct
acgctggtggaaaatcagcaggcggttattgagtatcgaccgttggggacgattctggcg
attatgccgtggaattttccgttatggcaggtgatgcgtggtgctgttcccatcattctt
gctggtaacggctacttacttaaacatgcgccgaatgtgatgggctgtgcacagctcatt
gcccaggtgtttaaagatgcgggtatcccacaaggcgtatatggctggctgaatgccgac
aacgacggtgtcagtctgatgattaaagactcgcgcattgctgctgtcacagtgaccgga
agtgttcgtgctggagcggctattggcgcacaggctggagcggcactgaaaaaatgcgta
ctggaactgggtggttcggatccgtttattgtgcttaacgatgccgatctggaactggcg
gtgaaagcggcggtagccggacgttatcagaataccggacaggtttgtgcagcggcaaaa
cgctttatcatcgaagagggaattgcttcggcatttaccgaacgttttgtggcagctgcg
gcagccttgaaaatgggcgatccccgtgatgaagagaacgctctcggaccaatggctcgt
tttgatttacgtgatgagctgcatcatcaggtggaaaaaacactggcgcagggtgcgcgt
ttgttactgggcggggaaaagatggctggggcaggtaactactatccgccaacggttctg
gcgaatgttaccccagaaatgaccgcgtttcgggaagaaatgtttggccccgttgcggca
atcaccattgcgaaagatgcagaacatgcgctggaactggctaatgatagtgagttcggc
ctttcagcgaccattttcaccaccgacgaaacacaggccagacagatggcggcacgtctg
gaatgcggtggggtgtttatcaatggttattgtgccagcgatgcgcgagtcgcctttggt
ggcgtgaagaagagtggctttgggcgtgagctttcccattttggcttacacgaattctgt
aatatccagacggtgtggaaagaccggatctga

DBGET integrated database retrieval system