KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1950Help
Entry
c1950             CDS       T00106                                 

Gene name
sotB
Definition
(GenBank) Sugar efflux transporter
  KO
K08159  MFS transporter, DHA1 family, L-arabinose/isopropyl-beta-D-thiogalactopyranoside export protein
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecc02000]
    c1950 (sotB)
Transporters [BR:ecc02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    c1950 (sotB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: AAN80407
UniProt: Q8FHE6
Position
1792932..1794122
Genome map
AA seq 396 aa AA seqDB search
MTTNTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAHSFHMQTAQVGIMLTIYAWV
VALMSLPFMLMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWS
ITASLAIRMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGALIT
LLCLIKLLPLLPSEHSGSLKSLPLLFRRPALMSIYLLTVVVVTAHYTAYSYIEPFVQNIA
GFSANFATALLLLLGGAGIIGSVIFGKLGNQYASALVSTAIALLLVCLALLLPAANSEIH
LGVLSIFWGIAMMIIGLGMQVKVLALAPDATDVAMALFSGIFNIGIGAGALVGNQVSLHW
SMSMIGYVGAVPAFAALIWSIIIFRRWPVTLEEQTQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaacactgtttcccgcaaagtagcgtggctacgggtcgttacgctggcagtc
gccgcctttatcttcaataccaccgaatttgtccctgttggcctgctctctgacattgcg
catagttttcacatgcaaaccgctcaggtcggcatcatgttgacaatttatgcatgggta
gtggcgctaatgtcattgccttttatgttaatgaccagccaggttgaacgccgcaaatta
ctgatctgcctgtttgtggtgtttattgccagccacgtactgtcgtttttatcgtggagt
tttaccgttctggtgatcagtcgtattggtgtggcttttgcacatgcgattttctggtct
attacggcgtctctggcgatccgtatggctccggccgggaagcgagcacaggcattgagt
ttaattgccaccggtacagcactggcaatggtattaggtttacctctcgggcgcattgtg
gggcagtattttggctggcgaatgaccttcttcgcgattggtatcggggcgcttattacc
cttttgtgcctgattaagttacttcccttgctgcccagtgagcattccggttcattgaaa
agcctcccgctattgttccgccgcccggcattgatgagcatttatttgttaactgtggtg
gttgtcaccgcccattacacggcatacagctatatcgagccttttgtacaaaacattgcg
ggattcagcgccaactttgccacggcattactgttattactcggtggtgcgggcattatt
ggcagcgtgattttcggtaaactgggtaatcagtatgcgtctgcgttggtgagtacagcg
attgcgctattgctggtgtgcctggcgctgctgctacctgcggcgaacagtgaaatacac
ctcggggtgctgagtattttctgggggatcgcgatgatgatcatcgggcttggtatgcag
gttaaagtgctggcgctggcaccagatgccaccgacgtcgcgatggcgctattctccggg
atatttaatattggaatcggcgcgggtgcgttggtaggtaatcaggtgagtctgcactgg
tcaatgtcgatgattggttatgtgggcgcggtgcctgcttttgctgcgttaatatggtca
atcatcatttttcgccgctggccagtgacactcgaagaacagacgcaatag

DBGET integrated database retrieval system