KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2004Help
Entry
c2004             CDS       T00106                                 

Gene name
fumA
Definition
(GenBank) Fumarate hydratase class I, aerobic
  KO
K01676  fumarate hydratase, class I [EC:4.2.1.2]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00020  Citrate cycle (TCA cycle)
ecc00620  Pyruvate metabolism
ecc01100  Metabolic pathways
ecc01110  Biosynthesis of secondary metabolites
ecc01120  Microbial metabolism in diverse environments
ecc01130  Biosynthesis of antibiotics
ecc01200  Carbon metabolism
Module
ecc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    c2004 (fumA)
   00620 Pyruvate metabolism
    c2004 (fumA)
Enzymes [BR:ecc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     c2004 (fumA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fumerase_C Fumerase Myosin_head
Motif
Other DBs
NCBI-ProteinID: AAN80464
UniProt: P0AC34
Position
complement(1847426..1849072)
Genome map
AA seq 548 aa AA seqDB search
MSNKPFHYQAPFPLKKDDTEYYLLTSEHVSVSEFEGQEILKVAPEALTLLARQAFHDASF
MLRPAHQQQVADILRDPEASENDKYVALQFLRNSDIAAKGVLPTCQDTGTAIIVGKKGQR
VWTGGGDEAALARGVYNTYIEDNLRYSQNAPLDMYKEVNTGTNLPAQIDLYAVDGDEYKF
LCIAKGGGSANKTYLYQETKALLTPGKLKNYLVEKMRTLGTAACPPYHIAFVIGGTSAET
NLKTVKLASAKYYDELPTEGNEHGQAFRDVELEKELLIEAQNLGLGAQFGGKYFAHDIRV
IRLPRHGASCPVGMGVSCSADRNIKAKINRQGIWIEKLEHNPGKYIPEELRKAGEGEAVR
VDLNRPMKEILAQLSQYPVSTRLSLNGTIIVGRDIAHAKLKERMDNGEGLPQYIKDHPIY
YAGPAKTPEGYASGSLGPTTAGRMDSYVDQLQAQGGSMIMLAKGNRSQQVTDACKKHGGF
YLGSIGGPAAVLAQGSIKSLECVEYPELGMEAIWKIEVEDFPAFILVDDKGNDFFQQIQL
TQCTRCVK
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacaaaccctttcattatcaggctccttttccactcaaaaaagatgatactgag
tattacctgctaaccagcgaacacgttagcgtatctgaatttgaagggcaggagattttg
aaagtcgcacccgaagcgttaactctgttggcgcgtcaggcgtttcatgatgcgtcattt
atgctgcgtccggctcaccaacaacaggtggccgacattctgcgtgacccggaggccagc
gaaaatgataaatatgtggcgctgcaattcctgcgtaactccgacatcgcggcaaaaggc
gttctgccaacctgtcaggataccggcaccgcgattattgttggtaaaaaagggcagcgt
gtatggaccggtggcggtgatgaagcggcgctggcgcgcggtgtctataacacttatatc
gaggataatctgcgctactcgcaaaacgcgccgctggatatgtataaagaggtgaatacc
ggcaccaacttgccagcgcagatcgatctttatgccgttgatggcgacgagtacaaattc
ctctgtatcgccaaaggtggcggttcggcaaacaagacgtatctctatcaggaaaccaaa
gcgttactgacgccgggaaaactgaaaaattacctggttgagaagatgcgcacgctgggt
acggcggcctgtcctccgtatcatattgcgttcgttattggtggaacttctgcagaaacg
aatcttaaaacggtgaaactcgcttccgctaaatactatgatgaactgccaacggaaggg
aatgagcacggtcaggcgttccgcgatgtggaactggaaaaagaattgctgatcgaagcg
caaaatcttggtctgggtgcgcagtttggtggtaaatacttcgctcatgacatccgcgtg
attcgcctgccacgtcacggcgcatcctgcccggtcggtatgggcgtctcctgttctgct
gaccgtaatatcaaagcgaagatcaaccgtcaggggatctggatcgaaaaactggaacat
aatccaggcaaatatatcccggaagagctgcgcaaagcaggagaaggcgaagcggtgcgc
gttgaccttaaccgtccgatgaaagagatcctcgcacagttgtcgcagtatcccgtttct
acacgcttatcgcttaacggcacgattatcgtcggtcgtgatattgctcacgccaaactg
aaagagcggatggataacggtgaagggctgccgcagtacattaaagatcatccgatttac
tacgcgggtccggccaaaacgccggaaggttatgcctccggttctcttggcccaacgacc
gccggacggatggattcttatgtcgatcaactgcaagcgcagggcggaagtatgatcatg
ctggcgaaaggcaaccgcagccagcaggtgacggatgcctgtaaaaaacacggcggcttc
tacctcggcagtatcggtggtccggcagctgtattggcgcagggaagtattaagagcctg
gaatgtgttgaatatccggaactgggaatggaagccatctggaaaattgaagtggaagat
ttcccggcgtttatccttgtggatgataaaggaaatgacttcttccagcagatacaactc
acacaatgcacccgctgtgtgaaataa

DBGET integrated database retrieval system