KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2007Help
Entry
c2007             CDS       T00106                                 

Gene name
uidC
Definition
(GenBank) Membrane-associated protein uidC precursor
  KO
K16140  putative glucuronide porin
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecc02000]
    c2007 (uidC)
Transporters [BR:ecc02000]
 Other Transporters
  Pores ion channels [TC:1]
   c2007 (uidC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OprD
Motif
Other DBs
NCBI-ProteinID: AAN80467
UniProt: A0A0H2V7K4
Position
complement(1852100..1853365)
Genome map
AA seq 421 aa AA seqDB search
MRKIVAMAVICLTAASGLTSAYAAQLADDEAGLRIRLKNELRRADKPSAGAGRDIYAWVQ
GGLLDFNSGYYSNIIGVEGGAYYVYKLGARADMSTRWYLDGDKSFGFTLGAVKIKPSESS
LLKLGRFGTDYSYGSLPYRIPLMAGSSQRTLPTVSEGALGCWALTPNIDLWGMWRSRVFL
WTDSTTGIRDEGVYNSQTGKYDKHRARSFLAASWHDDTSRYSLGASVQKDVSNQIQSILE
KSIPLDPNYTLKGELLGFYAQLEGLSRNTSQPNETALVSGQLTWIAPWGSVFGSGGYLRH
AMNGAVVDTDIGYPFSLSLDRNREGMQSWQLGVNYRLTPQFTLTFAPIVTRGYESSKRDV
RIEGAGILGGMNYRVSEGPLQGMNFFLAADKGREKRDGSALGDRLNYWDVKMSIQYDFML
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatagtggccatggccgttatttgcctgacggctgcctctggccttacctct
gcttacgcggcgcaactggctgacgatgaagcgggactacgcatcagactgaaaaatgaa
ttacgcagggctgataagcccagtgctggcgcggggagagatatttacgcatgggtacag
ggaggattgctcgatttcaatagtggttattattccaatattattggcgttgaaggcggg
gcgtattatgtttataaattaggtgctcgtgctgatatgagcacccggtggtatcttgat
ggtgataaaagttttggctttaccctgggggcagtaaaaataaaacccagtgaaagtagt
ctgcttaaattaggtcgcttcgggacggattatagttatggtagcttaccttatcgtatt
ccgttaatggctggcagttcgcaacgtacattaccgacagtttctgaaggagcattaggt
tgttgggctttaacgccaaatattgacctgtggggaatgtggcgttcacgagtattttta
tggaccgattcaacaaccggtattcgtgatgaaggggtgtataacagccagacgggaaaa
tacgataaacatcgcgcacgttcttttttagccgccagttggcatgatgataccagtcgc
tattctctgggggcatcggtacagaaagatgtttccaatcagatacaaagtattctcgag
aaaagcataccgctcgacccgaattatacgttgaaaggggagttgctcggcttttacgcg
caactcgaaggtttaagtcgtaataccagccagcccaatgaaacggcgttggttagtgga
caattgacctggattgcgccgtggggaagcgtatttggcagtggtggttatttgcgccat
gcaatgaatggtgccgtggtggataccgacattggctatcccttttcattaagtcttgat
cgtaaccgtgaaggaatgcagtcctggcaattgggcgttaactatcgtttaactccgcaa
tttacgctgacatttgcaccgattgtgactcgcggctatgaatccagtaaacgagatgtg
cggattgaaggcgcgggtatcttaggtggtatgaactatcgggtcagcgaagggccgtta
caagggatgaatttctttcttgctgccgataaagggcgggaaaagcgcgatggcagtgcg
ctgggcgatcgcctgaattactgggatgtgaaaatgagtattcagtatgactttatgctg
aagtaa

DBGET integrated database retrieval system