KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2012Help
Entry
c2012             CDS       T00106                                 

Gene name
malI
Definition
(GenBank) Maltose regulon Regulatory protein malI
  KO
K16136  LacI family transcriptional regulator, maltose regulon regulatory protein
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecc03000]
    c2012 (malI)
Transcription factors [BR:ecc03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    c2012 (malI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_1 LacI Peripla_BP_3 Peripla_BP_4 HTH_3 ANF_receptor RPS31 HTH_31
Motif
Other DBs
NCBI-ProteinID: AAN80472
UniProt: A0A0H2V9T7
Position
complement(1858673..1859701)
Genome map
AA seq 342 aa AA seqDB search
MATAKKITIHDVALAAGVSVSTVSLVLSGKGRISTATGERVNAAIEELGFVRNRQASALR
GGQSGVIGLIVRDLSAPFYAELTAGLTEALEAQGRMVFLLHGGKDGEQLAQRFSLLLNQG
VDGVVIAGAAGSSDDLRRIAEEKAIPVIFASRASYLDDVDTVRPDNMQAAQLLTEHLIRN
GHQRIAWLGGQSSSLTLAERVGGYCATLLKFGLPFHSDWVLECTSSQKQAAEAITALLRH
NPTISAVVCYNETIAMGAWFGLLKAGRQSGESGVDRYFEQQVSLAAFTDATPTTLDDIPV
TWASTPARELGTTLADRMMQKITHEETHSRNLIIPARLIAEK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgccaaaaaaataaccattcatgatgttgcgctggctgcgggcgtgtcggta
agtaccgtttcgctggtgcttagtggcaaagggcgaatctctaccgccacaggagaacgc
gttaacgccgccattgaagagctgggatttgtgcgcaatcgccaggcgtcggcgctgcgc
ggcgggcaaagcggcgtcattggtttgatcgtccgtgatttatctgcgccgttttacgcc
gaattgacggccggattgacggaagctctggaagcgcagggacggatggtttttttgctt
cacggcggtaaagacggcgagcagctggcacagcggttttcactattactgaatcagggt
gtcgatggtgtggtcattgccggggctgcaggaagcagcgatgacctgcgacggatagca
gaagaaaaagctatcccggtgattttcgcttcccgtgccagttatcttgatgacgttgat
acggttcgcccggacaacatgcaggctgcacagttgttgacggagcatctcattcgcaat
gggcatcagcgtatcgcctggctgggaggacaaagttcctcattaaccctggcagaacgg
gtggggggctattgtgcgactctactaaaatttggcctgccgtttcacagcgattgggtg
ctggagtgcacttccagccagaagcaagccgcggaagctatcacggcgcttttacgtcat
aacccgaccatcagcgccgtggtttgctataacgaaactattgcgatgggggcatggttt
ggtttgctgaaagcaggaaggcaaagcggggaaagcggagtcgatcgttactttgagcaa
caggtttcgctggcggcatttaccgatgcaacgccaaccacacttgatgatatacccgtt
acctgggccagcacgccagcgcgggaacttggtaccacacttgcggatcgcatgatgcaa
aaaatcacccatgaagagacgcattctcgcaatcttattattcctgcccggctcattgcg
gagaaataa

DBGET integrated database retrieval system