KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2029Help
Entry
c2029             CDS       T00106                                 

Gene name
tyrS
Definition
(GenBank) Tyrosyl-tRNA synthetase
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    c2029 (tyrS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecc01007]
    c2029 (tyrS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ecc03016]
    c2029 (tyrS)
   03029 Mitochondrial biogenesis [BR:ecc03029]
    c2029 (tyrS)
Enzymes [BR:ecc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     c2029 (tyrS)
Amino acid related enzymes [BR:ecc01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   c2029 (tyrS)
Transfer RNA biogenesis [BR:ecc03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    c2029 (tyrS)
 Prokaryotic Type
    c2029 (tyrS)
Mitochondrial biogenesis [BR:ecc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    c2029 (tyrS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1b S4
Motif
Other DBs
NCBI-ProteinID: AAN80489
UniProt: Q8FH88
Structure
PDB: 

Position
complement(1876477..1877763)
Genome map
AA seq 428 aa AA seqDB search
MEILMASSNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSLHLGHLVPLL
CLKRFQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDC
GENSAIAANNYDWFGNMNVLTFLRDIGKHFSVNQMINKEAVKQRLNREDQGISFTEFSYN
LLQGYDFACLNKQYGVVLQIGGSDQWGNITSGIDLTRRLHQNQVFGLTVPLITKADGTKF
GKTEGGAVWLDPKKTSPYKFYQFWINTADADVYRFLKFFTFMSIEEINALEEEDKNSGKA
PRAQYVLAEQVTRLVHGEDGLQAAKRITECLFSGSLSALSEADFEQLAQDGVPMVEMEKG
ADLMQALVDSELQPSRGQARKTIASNAITINGEKQSDPEYFFKEEDRLFGRFTLLRRGKK
NYCLICWK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggagattttgatggcaagcagtaacttgattaaacaattgcaagagcgggggctggta
gcccaggtgacggacgaggaagcgttagcagagcgactggcgcaaggcccgatcgcgctc
tattgcggcttcgatcctaccgctgacagcttgcatttggggcatcttgttccattgtta
tgcctgaaacgcttccagcaggcgggccacaagccggttgcgctggtaggcggcgcgacg
ggtctgattggcgacccgagcttcaaagctgccgagcgtaagctgaacactgaagaaact
gttcaggagtgggtggacaaaatccgcaagcaggttgccccgttcctcgatttcgactgt
ggagaaaactctgctatcgcggcgaacaactatgactggttcggcaatatgaatgtgctg
accttcctgcgcgatattggcaaacacttctccgttaaccagatgatcaacaaagaagcg
gttaagcagcgtctcaaccgtgaagatcaggggatttcgttcactgagttttcctacaac
ctgttgcagggttatgacttcgcctgtctgaacaaacagtacggtgtggtgctgcaaatc
ggtggttctgaccagtggggtaacatcacttctggtatcgacctgacccgtcgtctgcat
cagaatcaggtgtttggcttgaccgttccgctgatcaccaaagcagacggcaccaaattt
ggtaaaactgaaggcggcgcagtctggttggatccgaagaaaaccagcccgtacaaattc
taccagttctggatcaacactgcggatgccgacgtttaccgcttcctgaagttcttcacc
ttcatgagcattgaagagatcaacgccctggaagaagaagataaaaacagcggtaaagca
ccgcgcgcccagtatgtgcttgcagaacaggtgacacgtctggtgcatggtgaagacggt
ttgcaggcggcaaaacgtattaccgaatgcctgttcagcggttccttgagtgcgctgagt
gaagcggacttcgaacagctggcgcaggacggcgtaccgatggttgagatggaaaagggc
gcagacctgatgcaggcgctggtcgattctgaactgcaaccttcccgtggtcaggcgcgt
aaaactatcgcctccaatgccatcaccattaacggtgaaaaacagtccgatcctgaatac
ttctttaaagaagaagatcgtctgtttggtcgttttaccttactgcgtcgtggcaaaaag
aattactgtctgatttgctggaaataa

DBGET integrated database retrieval system