KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c3312Help
Entry
c3312             CDS       T00106                                 

Gene name
ygbO
Definition
(GenBank) Protein ygbO
  KO
K06176  tRNA pseudouridine13 synthase [EC:5.4.99.27]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ecc03016]
    c3312 (ygbO)
Enzymes [BR:ecc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.27  tRNA pseudouridine13 synthase
     c3312 (ygbO)
Transfer RNA biogenesis [BR:ecc03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    c3312 (ygbO)
 Prokaryotic Type
    c3312 (ygbO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruD
Motif
Other DBs
NCBI-ProteinID: AAN81761
UniProt: Q8FEJ7
Structure
PDB: 

Position
complement(3153464..3154513)
Genome map
AA seq 349 aa AA seqDB search
MIEFDNLTYLHGKPQGTGLLKANPEDFVVVEDLGFEPDGEGEHILVRILKNGCNTRFVAD
ALAKFLKIHAREVSFAGQKDKHAVTEQWLCARVPGKEMPDLSAFQLEGCQVLEYARHKRK
LRLGALKGNAFTLVLREVSNRDDVEQRLIDICVKGVPNYFGAQRFGIGGSNLQGALRWAQ
TNTPVRDRNKRSFWLSAARSALFNQIVAERLKKADVNQVVDGDALQLAGRGSWFVATTEE
LAELQRRVNDKELMITAALPGSGEWGTQREALAFEQAAVAEETELQTLLVREKVEAARRA
MLLYPQQLSWNWWDDVTVEIRFWLPAGSFATSVVRELINTTGDYAHIAE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgattgagtttgataatctcacttacctccacggtaaaccgcaaggcaccgggctgctg
aaagcgaatccggaagactttgtggtggtggaagatttgggctttgagcctgatggtgaa
ggtgagcatattctggttagaatcctcaaaaacggttgcaatacccgttttgtggcggat
gcactggcgaaattcctgaaaattcatgcccgtgaagtcagcttcgctgggcaaaaagat
aaacatgctgttacggaacagtggttatgcgctcgcgtgccgggcaaagagatgcccgat
ctgagcgcctttcaactggaaggctgccaggtgctggagtatgcgcggcacaagcgcaag
ctgcgtttaggggcgctgaaaggtaacgcctttaccctggtactacgcgaagtgagcaat
cgcgatgacgttgaacaacgtctgatcgatatttgcgtaaaaggtgtaccgaactacttc
ggtgcccaacgttttgggattggcggtagcaacttgcagggtgcgctgcgctgggcgcaa
accaatactccggtgcgcgatcgcaataaacgtagtttttggttgtcggcagcccgcagt
gcgttgtttaatcagattgttgctgagcgcctcaaaaaagcagacgttaatcaagttgtt
gacggcgatgcgctacaattagccggacgtggtagctggtttgtcgcaaccaccgaagaa
ctggcggaattacagcgtcgcgtcaacgataaagagctgatgataaccgccgcattgccg
ggcagtggcgaatggggaactcagcgtgaagcgctggcattcgaacaagcagctgtcgcc
gaagaaactgaattacaaaccttactggtgcgcgaaaaagttgaagccgcgcgcagagcg
atgctgctgtatccgcaacaattaagctggaactggtgggatgacgtcaccgtagaaatc
cgtttctggcttccggcgggaagttttgcaaccagcgttgtcagggaacttatcaacaca
acaggtgattatgcgcatattgctgagtaa

DBGET integrated database retrieval system