KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c3314Help
Entry
c3314             CDS       T00106                                 

Gene name
ygbP
Definition
(GenBank) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  KO
K00991  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC:2.7.7.60]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00900  Terpenoid backbone biosynthesis
ecc01100  Metabolic pathways
ecc01110  Biosynthesis of secondary metabolites
ecc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    c3314 (ygbP)
Enzymes [BR:ecc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.60  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
     c3314 (ygbP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IspD NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AAN81763
UniProt: Q8FEJ5
Structure
PDB: 

Position
complement(3154989..3155699)
Genome map
AA seq 236 aa AA seqDB search
MATTHLDVCAVVPAAGFGRRMQTECPKQYLSIGNQTILEHSVHALLAHPRVKRVVIAISP
GDSRFAQLPLANHPRITVVDGGEERADSVLAGLKAAGDAQWVLVHDAARPCLHQDDLARL
LALSETSRTGGILAAPVRDTMKRAEPGKNAIAHTVDRNGLWHALTPQFFPRELLHDCLTR
ALNEGATITDEASALEYCGFHPQLVEGRADNIKVTRPEDLALAEFYLTRTIHQENT
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccactcatttggatgtttgcgccgtggttccggcggccggatttggccgccga
atgcaaacggaatgtcctaagcaatatctctcaatcggtaatcaaaccattcttgaacac
tcggtgcatgcgctgctggcgcatcccagggtgaaacgtgtcgtcattgccataagtcct
ggcgatagccgctttgcacaacttcctctggcgaatcatccacgaatcacggttgttgat
ggtggtgaagagcgtgccgattccgtgctggcaggtctgaaagccgctggcgacgcgcag
tgggtattggtgcatgacgccgctcgtccttgtctgcatcaggatgacctcgcgcgattg
ttggcgttgagcgaaaccagccgcacgggagggatcctcgctgcgccggtgcgcgatacg
atgaaacgtgccgaaccgggcaaaaatgccattgctcataccgttgatcgcaacggctta
tggcacgcgctgacgccgcaatttttccctcgtgagctgttacatgactgcctgacgcgc
gctctaaatgaaggcgctaccattaccgatgaggcctcggcgctggaatattgcggtttt
catccgcaacttgttgaaggccgcgcggataacatcaaggtaacgcgcccggaggatttg
gcgctggccgaattttacctcacccgaaccatccatcaggagaatacataa

DBGET integrated database retrieval system