KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c3399Help
Entry
c3399             CDS       T00106                                 

Definition
(GenBank) Hypothetical protein
  KO
K11910  type VI secretion system protein VasJ
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecc02044]
    c3399
Secretion system [BR:ecc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   c3399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasJ ImpA_N
Motif
Other DBs
NCBI-ProteinID: AAN81844
UniProt: A0A0H2VA46
Position
3242493..3244130
Genome map
AA seq 545 aa AA seqDB search
MWKSMGKTPMSELLQKLTRSCFADRDALDVARTQAALWQTWLLPVTADTPVGEDPGYHDD
FLRIRDEMNKLSGADTDLICQLAESLLLTQAKDVRIATYYIWARLHRDGERGLAEGLALL
TGLVERFGTQLLPSRPASRKMALEWLAGEKMLDSLARYPEVAKEDFANIVAALNLLTVSF
AAWPEDQHSPSLMPLINALESRLAQSGGMNAVVPQNSSGVPAPSSPVDAPQVQTITSGRD
LLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPDVDGKTRLAPPRTESRNQLKR
LYAQQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALTKAGVPWDRWTAVIRQDLALLLE
RLPGLENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEA
LAMADSQGVEAALGWIQTRPGITTARQRLLLRLLMARVAEQYGKNEMALLLLEELDTAAQ
GITLTQWEPELLFEVKARQLKLLRLRAHRHADKAALARKMDALLGSLVAIDPARTAVLCD
TQHKD
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagagtatggggaagacgccgatgagtgaactgttgcaaaagctgacccgtagc
tgttttgccgaccgggatgcactggatgtggcgcgaacacaggcggcgctgtggcagaca
tggctgctgccggtgacggcagatacgccggtcggggaagaccccggctaccacgacgat
tttctgcgtatccgcgacgagatgaacaaactttccggcgcggatacggacctcatctgc
cagcttgccgaatccctgctgctgacgcaggcaaaagacgtgcgcatcgccacttactac
atctgggcgcgactgcaccgcgacggtgagcgcggactggcggaaggactggcgctgctg
accggactggtggaacgcttcggtacgcaactgctgccctcgcgcccggccagccggaaa
atggcgctggagtggctggcgggggaaaagatgctcgacagccttgcccgctacccggaa
gtggcaaaagaggattttgcgaacattgttgccgccctgaatctgctgacggtttccttc
gccgcgtggcccgaagaccagcattccccctccctgatgccgctgattaacgcgctggaa
tcgcgtctggcacagtcgggcggaatgaacgcggtggtgccgcagaacagcagcggcgtt
ccggcaccgtcatccccggtggatgcgccgcaggtacagaccatcacctccggacgtgac
ctgctcgaccaggcgaaagtgctggcccgttatctgaacgaacagccgcagggctggctt
tcggcgcaccggctgatgaaaaccctgcgctgggatacggtgcatgaactgccgccggac
gtggacggcaaaacccggctggccccgccgcgcaccgagtcacgcaaccagcttaagcgg
ctgtatgcccagcagaactggacggaactgctggagcaggccgacctgatgttcagcacc
ggcgtcagtcatttctggctggacattcagtggtatctgcatcaggcgctgactaaggcg
ggcgtaccgtgggacaggtggacagccgttatccgtcaggacctggcgttactgctggaa
cgcctgccagggctggaaaatctggcatggaacgacggcacaccgttcgccgacgaggtg
acgcgcaactggatagcgcagcaggtcatgatgcgggaagacggcgcatggcttgcgggg
aaagccgctgtaccgacagacgacgccacaaatgacgtactggcgctggagccggaagca
ctggcgatggcagacagtcagggcgtggaagcggcgctgggctggatacagacccgtccg
ggcatcaccacggcacgacagcgcctgttattgcggctgctgatggcacgggtggcggaa
cagtacggtaaaaacgagatggcgctcctgctgctggaagaactggataccgccgcacag
ggaataacgctgacgcagtgggagccagaactgctgtttgaagtaaaagcccggcaactg
aaactgctgcgcctgcgggcacatcgccacgcggacaaggcggcgcttgcccggaaaatg
gacgctctgctgggttcgctggtggcaatcgatccggcgcggacagcggtactgtgtgat
acgcagcataaggactga

DBGET integrated database retrieval system