KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c3446
Entry
c3446             CDS       T00106                                 

Definition
(GenBank) Xanthine dehydrogenase iron-sulfur binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00230  Purine metabolism
ecc01100  Metabolic pathways
ecc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    c3446
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AAN81891
UniProt: A0A0H2VBT6
Position
3299930..3300409
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGMPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLFLATWAEGKEIRTLEGEAKGGKLSHVQLAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcgccaggaatgccgctttcggaactactccgagaacaagggcttcttagtgtc
aaacaaggttgctgcgtaggcgaatgcggtgcctgtacggtgctggtcgacggcactgcg
atagacagttgcttattccttgcgacctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggtaaactttctcatgtccaactggcttatgcgaaatctggtgca
gtgcaatgcgggttttgtacgccgggcctgattatggctaccacggcgatgctggcaaaa
ccacgcgaaaaaccattaaccattacggaaattcgtcgtggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system