KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c4123Help
Entry
c4123             CDS       T00106                                 

Gene name
slyD
Definition
(GenBank) FKBP-type peptidyl-prolyl cis-trans isomerase slyD
  KO
K03775  FKBP-type peptidyl-prolyl cis-trans isomerase SlyD [EC:5.2.1.8]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ecc03110]
    c4123 (slyD)
Enzymes [BR:ecc01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     c4123 (slyD)
Chaperones and folding catalysts [BR:ecc03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    c4123 (slyD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-ProteinID: AAN82561
UniProt: P0A9L0
Structure
PDB: 

Position
complement(3909295..3909885)
Genome map
AA seq 196 aa AA seqDB search
MKVAKDLVVSLAYQVRTEDGVLVDESPVSAPLDYLHGHGSLISGLETALEGHEVGDKFDV
AVGANDAYGQYDENLVQRVPKDVFMGVDELQVGMRFLAETDQGPVPVEITAVEDDHVVVD
GNHMLAGQNLKFNVEVVAIREATEEELAHGHVHGAHDHHHDHDHDGCCGGHGHDHGHEHG
GEGCCGGKGNGGCGCH
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagcaaaagacctggtggtcagcctggcctatcaggtacgtacagaagacggt
gtgttggttgatgagtctccggtgagtgcgccgctggactacctgcatggtcacggttcc
ctgatctctggcctggaaacagcgctggaaggtcatgaagttggcgacaaatttgatgtc
gctgttggcgcgaacgacgcttacggtcagtacgacgaaaacctggtgcagcgcgttcct
aaagacgtatttatgggcgttgatgaactgcaggtaggtatgcgtttcctggctgaaacc
gaccagggtccggtaccggttgaaatcactgcggttgaagacgatcacgtagtggttgat
ggtaaccacatgctggctggtcagaacctgaaattcaacgttgaagttgtggcgattcgc
gaagcgaccgaagaagaactggctcatggtcacgttcacggcgcgcacgatcaccaccac
gatcacgaccacgacggttgctgcggtggtcatggccacgatcacggtcatgaacacggt
ggcgaaggctgctgtggcggtaaaggcaacggcggttgcggttgccactaa

DBGET integrated database retrieval system