KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c4180Help
Entry
c4180             CDS       T00106                                 

Gene name
envZ
Definition
(GenBank) Osmolarity sensor protein envZ
  KO
K07638  two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC:2.7.13.3]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc02020  Two-component system
ecc02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    c4180 (envZ)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    c4180 (envZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecc01001]
    c4180 (envZ)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ecc02022]
    c4180 (envZ)
Enzymes [BR:ecc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     c4180 (envZ)
Protein kinases [BR:ecc01001]
 Histidine kinases
  OmpR family
   c4180 (envZ)
Two-component system [BR:ecc02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   c4180 (envZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: AAN82618
UniProt: A0A0H2VD53
Structure
PDB: 

Position
complement(3961381..3962733)
Genome map
AA seq 450 aa AA seqDB search
MRRLRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML
ELGTSERGGLSIRAWLPVPVTRAQGMTKEG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgattgcgcttctcgccacgaagttcatttgcccgtacgttattgctcatcgtc
accttgctgttcgtcagcctggtgacgacttatctggtggtgctgaacttcgcgattttg
ccgagcctccagcagtttaataaagtcctcgcgtacgaagtgcgtatgttgatgaccgac
aaactgcaactggaggacggcacgcagttggttgtgcctcccgctttccgtcgggagatc
taccgtgagctggggatctctctctattccaacgaagctgccgaagaggcaggtctgcgt
tgggcgcaacactatgaattcttaagccatcagatggcgcagcaactgggcggtccgacg
gaagttcgcgtcgaggtcaacaaaagttcgcctgtcgtctggctgaaaacctggttgtcg
cccaatatctgggtacgcgtgccgctaaccgaaattcatcagggcgatttctccccgctg
ttccgttatacgttggcgattatgctattggcgataggcggggcgtggctgtttattcgt
atccagaaccgaccgttggtcgatctcgaacacgcagccttgcaggtgggtaaagggatt
attccgccgccgctgcgtgaatatggcgcttcggaggtgcgttccgttacccgcgccttt
aaccatatggcggctggtgttaagcaactggcggatgaccgcacgctgctgatggcgggg
gtaagccatgatctgcgcacgccgctgacgcgtattcgtctggcgaccgagatgatgagc
gagcaggatggctacctggcagaatcgatcaataaagatatcgaagagtgcaacgccatc
attgagcagtttatcgactacctgcgcaccgggcaggagatgccgatggaaatggcggat
ctcaacgcagtactcggtgaggttattgctgccgaaagtggctatgagcgggaaattgaa
actgcgctttaccccggtagcattgaggtgaaaatgcacccgctgtcgatcaaacgcgcg
gtagcgaatatggtggtgaacgccgcccgctatggcaatggctggatcaaagtcagcagc
ggcacggagccgaatcgcgcctggtttcaggtagaagatgacggtccgggtattgcgcca
gaacagcgtaagcacctgttccagccgtttgttcgtggcgacagtgcgcgcactattagc
ggcacgggattagggctggcgattgtgcagcgtatcgtggataaccataacgggatgctg
gagcttggcaccagcgaacggggcgggctttccattcgcgcctggctgccagtgccggta
acgcgggcgcagggcatgacaaaagaagggtaa

DBGET integrated database retrieval system