KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c4255
Entry
c4255             CDS       T00106                                 
Symbol
ftsX
Name
(GenBank) Cell division protein ftsX
  KO
K09811  cell division transport system permease protein
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    c4255 (ftsX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ecc03036]
    c4255 (ftsX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecc02000]
    c4255 (ftsX)
Chromosome and associated proteins [BR:ecc03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    c4255 (ftsX)
Transporters [BR:ecc02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Cell division transporter
    c4255 (ftsX)
SSDB
Motif
Pfam: FtsX_ECD FtsX
Other DBs
NCBI-ProteinID: AAN82691
UniProt: P0AC31
Position
complement(4039521..4040606)
AA seq 361 aa
MVTCMEAWAMNKRDAINHIRQFGGRLDRFRKSVGGSGDGGRNAPKRAKSSPKPVNRKTNV
FNEQVRYAFHGALQDLKSKPFATFLTVMVIAISLTLPSVCYMVYKNVNQAATQYYPSPQI
TVYLQKTLDDDAAAGVVAQLQAEQGVEKVNYLSREDALGEFRNWSGFGGALDMLEENPLP
AVAVVIPKLDFQGTESLNTLRDRITQINGIDEVRMDDSWFARLAALTGLVGRVSAMIGVL
MVAAVFLVIGNSVRLSIFARRDSINVQKLIGATDGFILRPFLYGGALLGFSGALLSLILS
EILVLRLSSAVAEVAQVFGTKFDINGLSFDECLLLLLVCSMIGWVAAWLATVQHLRHFTP
E
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggtcacttgcatggaggcgtgggccatgaataagcgcgatgcaatcaatcacattcgg
cagtttggcgggcgtctggatcgcttccgtaaatcggtcggcggctctggcgacggcggt
cgtaacgcgccgaaacgcgcgaaatcctcgccaaaaccggtaaatcgcaaaaccaacgtt
ttcaacgaacaggtacgctatgccttccacggcgcattgcaggatctgaaaagcaaaccg
ttcgccacgtttttaacggtgatggttatcgccatctccctgacgctgcccagcgtctgt
tatatggtgtacaaaaacgttaaccaggcggcgacgcaatattatccgtcaccgcaaatc
actgtttatctgcaaaaaacgctggatgatgacgccgctgcgggcgtggtggcacagttg
caggccgagcaaggcgtggagaaagtgaattatctttctcgtgaagacgcactgggcgag
ttccgtaactggtctggttttggtggtgcgctggatatgctggaagaaaacccgcttccg
gcagtggcggtggtgatcccgaaactcgattttcaggggacggagtcactgaatacgctg
cgtgatcgtatcacgcagattaacggcattgacgaagtscggatggatgacagctggttt
gcccgcctggcggcgttgaccgggctggtcgggcgcgtttccgcgatgatcggcgtgttg
atggtggcagcagtgtttctcgtcatcggcaacagtgtgcgtctgagcatctttgctcgc
cgtgactctattaacgtgcagaaactgattggtgcgacggatggtttcatcctgcgcccg
ttcctgtacggtggcgcactgctgggattttctggcgcattgttgtcattaattttgtca
gaaattctggtgctgcgattgtcatcggcggttgcggaagtggcacaggttttcggaacg
aagtttgatatcaatggtttatcgttcgatgaatgcctgctattgctgctggtatgctcg
atgattggctgggtggcagcgtggcttgccacggtacaacatttacgccactttacgcct
gaataa

DBGET integrated database retrieval system