KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c4405Help
Entry
c4405             CDS       T00106                                 

Gene name
sgbU
Definition
(GenBank) Putative hexulose-6-phosphate isomerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00040  Pentose and glucuronate interconversions
ecc00053  Ascorbate and aldarate metabolism
ecc01100  Metabolic pathways
ecc01120  Microbial metabolism in diverse environments
Module
ecc_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    c4405 (sgbU)
   00053 Ascorbate and aldarate metabolism
    c4405 (sgbU)
Enzymes [BR:ecc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     c4405 (sgbU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 Glyco_hydro_114 UxuA PRMT5_TIM DPRP
Motif
Other DBs
NCBI-ProteinID: AAN82841
UniProt: A0A0H2VC01
Position
4187675..4188568
Genome map
AA seq 297 aa AA seqDB search
MRKSTPSGEASVRNHPLGIYEKALAKDLSWPERLVLAKSCGFDFVEMSVDETDERLSRLD
WSAAQRTSLVTAMIETGVAIPSMCLSAHRRFPFGSRDDAVRQRAREIMSKAIRLARDLGI
RTIQLAGYDVYYEDHDEGTQQRFAEGLAWAVEQAAASQVMLAVEIMDTAFMNSISKWKKW
DEMLASPWFTVYPDVGNLSAWGNDVPAELKLGIDRIAAIHLKDTQPVTEHSPGQFLDVPF
GEGCVDFVGIFKTLHELNYRGSFLIEMWTEKAKEPVLEIIQARRWIEARMQEAGFIC
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaatcgactccatctggggaggcaagcgtgcgtaatcatccgttaggcatttat
gaaaaagcgctggcgaaagatctctcctggccggagcggctggtgctggcaaaaagctgt
ggttttgattttgtcgaaatgtcggtggatgaaaccgacgaacggttgtcacgtcttgac
tggagcgccgcacaacgtacttcgctggttaccgcgatgatcgaaacgggtgttgctatt
ccgtcaatgtgcctgtccgcacatcgtcgttttccttttggtagccgggacgacgccgtg
cgccagcgggcgcgggagattatgagtaaagcgattcgcctggcgcgcgatctcggcatt
cgtactattcaactggcaggttacgacgtctattacgaagaccacgacgaaggcacccag
caacgttttgctgaagggctggcgtgggcggtcgaacaggcggcggcatcacaagtcatg
ctggcagtggagattatggatactgcgtttatgaactccatcagcaaatggaaaaaatgg
gacgagatgctcgcctcgccgtggttcaccgtctacccggacgtcggcaacctcagcgcc
tggggcaatgatgttcccgccgaactgaaactgggcatcgaccgtatcgccgccatccac
ctgaaagacactcaacccgttaccgaacatagccccggacagttcctcgatgtgccgttt
ggcgaaggctgtgtcgattttgttggcatcttcaaaacgctgcatgagctgaactatcgc
ggatcatttctgattgaaatgtggaccgaaaaagccaaagagccggtgctggagattatt
caggcgcggcgctggattgaagcgcgtatgcaggaggccggatttatatgttag

DBGET integrated database retrieval system