KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c4481Help
Entry
c4481             CDS       T00106                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    c4481
Enzymes [BR:ecc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     c4481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AAN82917
UniProt: A0A0H2VCD3
Position
complement(4263077..4263796)
Genome map
AA seq 239 aa AA seqDB search
MALPGLLCATEKPMKRSQINYVIDKAHAIAQTFRVCLPEFAYFTVDDWLQRERDNWQEVV
DLQLGWDITDFGRGDFNQTGLTLLTMRNGALGSAAYPKPYAEKMLQIQQDQQTPWHFHTH
KMEDILNRGGGDLCMQLAWANEANLCDDQRVITVSVDGQRRTMKPGETLVLKPGQGICLP
PRLYHRFWAEKAFVLGWEISMVNDDQHDNYFLEPGGRFPAIEEDEPVKWLLCSEYGILR
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctgcctggcttgctatgcgcaacggagaagccaatgaaacgttcacaaattaat
tatgttattgataaagcacatgccattgcgcagaccttccgcgtttgtttgccagagttc
gcctattttacggtggatgactggctgcagcgggaacgggataactggcaagaagtggtc
gacttacagctcggttgggatatcaccgattttggtcgtggtgatttcaaccaaacggga
ctaacactgctaacgatgcgcaacggcgcgctggggtcggcggcatatccaaaaccgtat
gctgagaaaatgttgcagatccaacaagatcagcagactccctggcattttcacacccac
aaaatggaagatatcctcaatcggggcggtggagacttatgcatgcagttggcctgggcc
aacgaagccaatctctgtgatgatcaacgagtcattaccgtgagtgttgatggtcagcgg
cgtaccatgaaacctggtgaaacgctggtgctaaagccggggcagggcatttgcctgccg
ccgcgtctgtatcatcgcttctgggcggaaaaagcgtttgttctcggctgggaaatctcg
atggtaaatgatgaccaacacgataattattttcttgagccgggaggacgttttccggcg
atagaagaagatgaaccggtgaaatggttattgtgcagtgagtatggaattttgcgctaa

DBGET integrated database retrieval system