KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c4901
Entry
c4901             CDS       T00106                                 
Symbol
yijE
Name
(GenBank) Hypothetical transport protein yijE
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
SSDB
Motif
Pfam: EamA DUF3119
Other DBs
NCBI-ProteinID: AAN83329
UniProt: P0ABT9
Position
4663054..4664025
AA seq 323 aa
MQSLKFLYRRIVSTGKLHTGSLMSAAGKSNPLAISGLVVLTLIWSYSWIFMKQVTSYIGA
FDFTALRCIFGALVLFIVLLLRGRGMRPTPFKYTLAIALLQTCGMVGLAQWALVSGGAGK
VAILSYTMPFWVVIFAALFLGERLRRGQYFAILIAAFGLFLVLQPWQLDFSSMKSAMLAI
LSGVSWGASAIVAKRLYARHPRVDLLSLTSWQMLYAALVMSVVALLVPQREIDWQPTVFW
ALAYSAILATALAWSLWLFVLKNLPASIASLSTLAVPVCGVLFSWWLLGENPGAVEGSGI
VLIVLALALVSRKKKEAVSVKRI
NT seq 972 nt   +upstreamnt  +downstreamnt
atgcagtcgctgaagtttctttaccggcgtatagtgtccacaggaaaactacacactgga
tctctcatgtctgccgcaggaaagagcaacccactggcaatcagtggcctggttgtgctc
acacttatctggagttatagctggattttcatgaagcaagtcaccagctacatcggtgcc
ttcgacttcaccgccttacgctgcattttcggcgctctcgttttattcatcgtcctttta
ttacgtggtcgcggaatgcgcccgacgccgtttaaatacaccttagccattgccctgtta
caaacctgcgggatggttggcctggcacagtgggcgctggtcagcggcggagcggggaag
gtggcaatcctgagctataccatgccgttctgggtggtaattttcgccgcgttgtttctc
ggtgaacgcctgcgacgtgggcaatatttcgcgatactgattgccgctttcggcttattt
ttggtgttgcagccgtggcaactcgatttctcttcgatgaaaagtgccatgctggcaatc
ctctccggtgtgagttggggggcgagcgcgattgttgctaaacgtctgtatgcccgccat
ccgcgcgtggatttattgtcgctaacatcctggcagatgctgtatgcggcgctggtgatg
agcgtggtcgctttactggtgccgcaacgtgaaattgactggcaacccaccgtgttctgg
gcgctggcctacagtgcgattctggcgacagcgctggcgtggagcttatggttgtttgta
ttgaaaaacttgcctgccagtattgccagcttaagcacactggccgttcccgtttgcggc
gtactcttttcctggtggctgctcggtgagaatccgggggcagttgaaggtagcggtatt
gtgctgattgtgctggcactggcgctggtgagccgtaagaaaaaagaagccgtcagtgta
aaaaggatctga

DBGET integrated database retrieval system