KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c5353Help
Entry
c5353             CDS       T00106                                 

Gene name
argI
Definition
(GenBank) Ornithine carbamoyltransferase chain I
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00220  Arginine biosynthesis
ecc01100  Metabolic pathways
ecc01110  Biosynthesis of secondary metabolites
ecc01130  Biosynthesis of antibiotics
ecc01230  Biosynthesis of amino acids
Module
ecc_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    c5353 (argI)
Enzymes [BR:ecc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     c5353 (argI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AAN83775
UniProt: Q8FAD6
Position
complement(5096127..5097131)
Genome map
AA seq 334 aa AA seqDB search
MSGFYHKHFLKLLDFTPAELNSLLQLAAKLKADKKSGKEEARLTGKNIALIFEKDSTRTR
CSFEVAAYDQGARVTYLGPSGSQIGHKESIKDTARVLGRMYDGIQYRGYGQEIVETLAEY
AGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKAFNEMTLVYAGDARNNMGNSMLEAAALT
GLDLRLVAPQACWPEAALVAECSALAQKHGGKITLTEDIASGVKGADFIYTDVWVSMGEP
KEKWAERIALLRDYQVNSKMMALTGNSQVKFLHCLPAFHDEQTTLGKKMAAEFGLYGGME
VTDEVFESPASIVFDQAENRMHTIKAVMVATLAK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggttttatcataagcatttcctgaaattactcgatttcacgccagctgaactc
aacagcttgttgcagttagccgcgaagctgaaagccgataagaaaagcggtaaagaagaa
gccagactcactggcaaaaacatcgcgctcatcttcgaaaaagactcgacccgtacccga
tgctctttcgaagttgccgcatatgaccagggtgctcgcgttacttatctcggcccaagc
ggcagccagattggtcacaaagagtcgattaaagacactgcccgcgtgcttggtcgcatg
tatgacggtattcagtatcgcggctatggtcaggagattgtcgaaacactggcggaatac
gctggcgtgccagtatggaacggcctgaccaatgagttccaccccacgcagctgctggcg
gatctcctcaccatgcaggagcatttgcccggcaaagcattcaacgaaatgacgctggtc
tatgcaggtgacgcgcgtaacaacatgggcaattcgatgctcgaagctgcggcgcttacc
ggtctggatttgcgtctggtcgcgccacaggcatgctggccggaagctgcgctggtcgcc
gaatgcagtgctctggcacaaaaacacgggggtaaaatcaccttgacggaagatatcgcc
tctggggttaaaggtgcagactttatctataccgatgtctgggtatcgatgggtgagccc
aaagagaaatgggcggagcgtattgccctgctgcgtgactatcaggtgaatagcaaaatg
atggccctgaccggtaattcgcaggttaagttcctccactgtctgcctgcatttcatgat
gagcaaaccacgctgggtaaaaaaatggccgcagaattcggtctgtatggtggaatggaa
gtcaccgatgaagtctttgaatctccggcaagtattgtctttgaccaggcagaaaaccgg
atgcacaccataaaagctgttatggtcgctacattagcaaaataa

DBGET integrated database retrieval system